MAGEA3 Antibody (6D10)

Images

 
Western Blot: MAGEA3 Antibody (6D10) [H00004102-M01] - Analysis of MAGEA3 expression in transfected 293T cell line by MAGEA3 monoclonal antibody (M01), clone 6D10.Lane 1: MAGEA3 transfected lysate (Predicted MW: 34.7 ...read more
Sandwich ELISA: MAGEA3 Antibody (6D10) [H00004102-M01] - Detection limit for recombinant GST tagged MAGEA3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, S-ELISA
Clone
6D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MAGEA3 Antibody (6D10) Summary

Immunogen
MAGEA3 (NP_005353, 44 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA
Specificity
MAGEA3 - melanoma antigen family A, 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAGEA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using
H00004102-M01 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28489076).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEA3 Antibody (6D10)

  • Antigen MZ2-D
  • Cancer/testis antigen 1.3
  • CT1.3 MAGE-3 antigen
  • CT1.3
  • HIP8
  • MAGE3 MAGEA6
  • MAGE3
  • MAGEA3
  • melanoma antigen family A, 3
  • melanoma-associated antigen 3
  • member 3
  • MGC14613

Background

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34754
Species: Ca, Hu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P
NBP1-30151
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41318
Species: Hu, Mu, Rt
Applications: ELISA, ICC, IF, IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-62688
Species: Hu
Applications: IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-54704
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85397
Species: Hu
Applications: IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-45722
Species: Hu
Applications: IHC, WB
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004102-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, S-ELISA

Publications for MAGEA3 Antibody (H00004102-M01)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MAGEA3 Antibody (H00004102-M01) (0)

There are no reviews for MAGEA3 Antibody (H00004102-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEA3 Antibody (H00004102-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEA3 Products

Bioinformatics Tool for MAGEA3 Antibody (H00004102-M01)

Discover related pathways, diseases and genes to MAGEA3 Antibody (H00004102-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEA3 Antibody (H00004102-M01)

Discover more about diseases related to MAGEA3 Antibody (H00004102-M01).
 

Pathways for MAGEA3 Antibody (H00004102-M01)

View related products by pathway.

PTMs for MAGEA3 Antibody (H00004102-M01)

Learn more about PTMs related to MAGEA3 Antibody (H00004102-M01).
 

Research Areas for MAGEA3 Antibody (H00004102-M01)

Find related products by research area.

Blogs on MAGEA3

There are no specific blogs for MAGEA3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEA3 Antibody (6D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEA3
Entrez
OMIM
Uniprot