MAGEA3 Antibody (6D10) - Azide and BSA Free

Western Blot: MAGEA3 Antibody (6D10) [H00004102-M01] - Analysis of MAGEA3 expression in transfected 293T cell line by MAGEA3 monoclonal antibody (M01), clone 6D10.Lane 1: MAGEA3 transfected lysate (Predicted MW: 34.7 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: MAGEA3 Antibody (6D10) [H00004102-M01] - Detection limit for recombinant GST tagged MAGEA3 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clone: 6D10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAGEA3 Antibody (6D10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MAGEA3 (NP_005353, 44 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA
• Specificity: MAGEA3 - melanoma antigen family A, 3
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MAGEA3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28489076).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEA3 Antibody (6D10) - Azide and BSA Free

• Antigen MZ2-D
• Cancer/testis antigen 1.3
• CT1.3 MAGE-3 antigen
• CT1.3
• HIP8
• MAGE3 MAGEA6
• MAGE3
• MAGEA3
• melanoma antigen family A, 3
• melanoma-associated antigen 3
• member 3
• MGC14613

Background

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAGEA3 Antibody (H00004102-M01)(2)

Publications using H00004102-M01

• Yamashita Yuki, Anczurowski Mark, Nakatsugawa Munehide et al. HLA-DP84Gly constitutively presents endogenous peptides generated by the class I antigen processing pathway. Nature Communications 2017-05-10 [PMID: 28489076] (WB, Mouse)
• Akiyama Y, Oshita C, Kume A et al. Alpha-type-1 polarized dendritic cell-based vaccination in recurrent high-grade glioma: a phase I clinical trial. BMC Cancer. 2012-12-27 [PMID: 23270484]

Bioinformatics

• Gene Symbol: MAGEA3
• Entrez:
  • 4102(Human)
• OMIM:
  • 300174(Human)
• Uniprot:
  • NP_005353()