MAGEA3 Antibody (4D9) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
MAGEA3 (NP_005353, 44 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MAGEA3 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
It has been used for ELISA and WB. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MAGEA3 Antibody (4D9) - Azide and BSA Free
Background
MAGEA3, also known as Melanoma-associated antigen 3, is a 34.7 kDa, 314 amino acid protein that is involved in increasing ubiquitin ligase activity as a member of the MAGEA family. Current research is being conducted to study the effects of the protein on diseases and disorders such as bile duct cancer, dyskeratosis, ocular melanoma, germ cell tumors, multiple types of carcinomas, avian influenza, testicular cancer, lung cancer, and lymphoma. The protein interacts with other proteins such as TRIM28, UBC, HTT, and SUMO2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for MAGEA3 Antibody (H00004102-M02) (0)
There are no publications for MAGEA3 Antibody (H00004102-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAGEA3 Antibody (H00004102-M02) (0)
There are no reviews for MAGEA3 Antibody (H00004102-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MAGEA3 Antibody (H00004102-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MAGEA3 Products
Research Areas for MAGEA3 Antibody (H00004102-M02)
Find related products by research area.
|
Blogs on MAGEA3