MAGEA3 Antibody (4D9)

Images

 
Immunocytochemistry/ Immunofluorescence: MAGEA3 Antibody (4D9) [H00004102-M02] - Analysis of monoclonal antibody to MAGEA3 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MAGEA3 Antibody (4D9) Summary

Immunogen
MAGEA3 (NP_005353, 44 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAGEA3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEA3 Antibody (4D9)

  • Antigen MZ2-D
  • Cancer/testis antigen 1.3
  • CT1.3 MAGE-3 antigen
  • HIP8
  • MAGE3 MAGEA6
  • melanoma antigen family A, 3
  • melanoma-associated antigen 3
  • member 3
  • MGC14613

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-45720
Species: Hu
Applications: WB, IHC, IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02553
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00002543-T01
Species: Hu
NBP1-85397
Species: Hu
Applications: IHC, IHC-P
NBP2-45722
Species: Hu
Applications: WB, IHC
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004102-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MAGEA3 Antibody (H00004102-M02) (0)

There are no publications for MAGEA3 Antibody (H00004102-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEA3 Antibody (H00004102-M02) (0)

There are no reviews for MAGEA3 Antibody (H00004102-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAGEA3 Antibody (H00004102-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEA3 Products

Bioinformatics Tool for MAGEA3 Antibody (H00004102-M02)

Discover related pathways, diseases and genes to MAGEA3 Antibody (H00004102-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEA3 Antibody (H00004102-M02)

Discover more about diseases related to MAGEA3 Antibody (H00004102-M02).
 

Pathways for MAGEA3 Antibody (H00004102-M02)

View related products by pathway.

PTMs for MAGEA3 Antibody (H00004102-M02)

Learn more about PTMs related to MAGEA3 Antibody (H00004102-M02).
 

Research Areas for MAGEA3 Antibody (H00004102-M02)

Find related products by research area.

Blogs on MAGEA3

There are no specific blogs for MAGEA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEA3 Antibody (4D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEA3
Uniprot