MAD2L2 Antibody [mFluor Violet 450 SE]

Product Discontinued

MAD2L2 Antibody [mFluor Violet 450 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-211 of human MAD2L2 (NP_006332.3).
  
  Sequence:
  MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAD2L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for MAD2L2 Antibody [mFluor Violet 450 SE]

• hREV7
• MAD2 mitotic arrest deficient-like 2 (yeast)
• MAD2BREV7 homolog
• MAD2-like protein 2
• Mitotic arrest deficient 2-like protein 2
• mitotic arrest deficient homolog-like 2
• mitotic spindle assembly checkpoint protein MAD2B
• REV7yeast, homolog)-like 2

Background

MAD2L2 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L2 is a homolog of MAD2L1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAD2L2