M-Cadherin/Cadherin-15 Recombinant Protein Antigen

Images

 
There are currently no images for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

M-Cadherin/Cadherin-15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human M-Cadherin/Cadherin-15.

Source: E. coli

Amino Acid Sequence: LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDH15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57991.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for M-Cadherin/Cadherin-15 Recombinant Protein Antigen

  • cadherin 15, M-cadherin (myotubule)
  • cadherin 15, type 1, M-cadherin (myotubule)
  • Cadherin-14
  • Cadherin-15
  • cadherin-3
  • CDH14
  • CDH14cadherin-14
  • CDH15
  • CDH3cadherin-15
  • CDHM
  • MCAD
  • MCadherin
  • M-Cadherin
  • MRD3
  • Muscle cadherin
  • muscle-cadherin

Background

Cadherins are a multigene family of Ca++-dependent cell adhesion molecules. They are transmembrane glycoproteins consisting of an extracellular domain, which mediates Ca++-dependent intercellular adhesion by homophilic interactions, a transmembrane region and a cytoplasmic domain. The extracellular domain is divided into a series of subdomains designated EC1-EC5. Homolgies between different members of the cadherin family are most prominent in the cytoplasmic domain and in EC1 and EC2 and much less so in EC5 of the extracellular domain and in the transmembrane region. The binding properties and specificities of the adhesive function are located in the N-terminal part of the molecules. Four members of the cadherin family have been identified and molecularly cloned from mammalian cells. These include the neuronal (N), epithelial (E), placental (P) and muscle (M) cadherins. M-cadherin is not found in fibroblasts but is expressed at low level in myoblasts and is upregulated following induction of myotube formation, suggesting a specific function in skeletal muscle cell differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-15238
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
AF761
Species: Mu
Applications: AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP1-89289
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-44421
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-47254
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03047
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-36953
Species: Hu
Applications: PEP-ELISA, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-89292
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83387
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP) (0)

There are no publications for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP) (0)

There are no reviews for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for M-Cadherin/Cadherin-15 Recombinant Protein Antigen (NBP2-57991PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional M-Cadherin/Cadherin-15 Products

Blogs on M-Cadherin/Cadherin-15

There are no specific blogs for M-Cadherin/Cadherin-15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our M-Cadherin/Cadherin-15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH15