LZTS2 Antibody


Western Blot: LZTS2 Antibody [NBP1-58275] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

LZTS2 Antibody Summary

Synthetic peptides corresponding to LZTS2(leucine zipper, putative tumor suppressor 2) The peptide sequence was selected from the N terminal of LZTS2. Peptide sequence EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LZTS2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LZTS2 Antibody

  • hLZTS2
  • KIAA1813leucine zipper putative tumor suppressor 2
  • LAPSER1Protein LAPSER1
  • leucine zipper, putative tumor suppressor 2


LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis. LZTS2 may negatively regulate axonal outgrowth by preventing the for


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for LZTS2 Antibody (NBP1-58275) (0)

There are no publications for LZTS2 Antibody (NBP1-58275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LZTS2 Antibody (NBP1-58275) (0)

There are no reviews for LZTS2 Antibody (NBP1-58275). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LZTS2 Antibody (NBP1-58275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LZTS2 Antibody Products

Related Products by Gene

Bioinformatics Tool for LZTS2 Antibody (NBP1-58275)

Discover related pathways, diseases and genes to LZTS2 Antibody (NBP1-58275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LZTS2 Antibody (NBP1-58275)

Discover more about diseases related to LZTS2 Antibody (NBP1-58275).

Pathways for LZTS2 Antibody (NBP1-58275)

View related products by pathway.

PTMs for LZTS2 Antibody (NBP1-58275)

Learn more about PTMs related to LZTS2 Antibody (NBP1-58275).

Research Areas for LZTS2 Antibody (NBP1-58275)

Find related products by research area.

Blogs on LZTS2

There are no specific blogs for LZTS2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LZTS2 Antibody and receive a gift card or discount.


Gene Symbol LZTS2

Customers Who Bought This Also Bought