LZTS2 Antibody

Images

 
Western Blot: LZTS2 Antibody [NBP1-58275] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LZTS2 Antibody Summary

Immunogen
Synthetic peptides corresponding to LZTS2(leucine zipper, putative tumor suppressor 2) The peptide sequence was selected from the N terminal of LZTS2. Peptide sequence EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LZTS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LZTS2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LZTS2 Antibody

  • hLZTS2
  • KIAA1813leucine zipper putative tumor suppressor 2
  • LAPSER1Protein LAPSER1
  • leucine zipper, putative tumor suppressor 2

Background

LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis. LZTS2 may negatively regulate axonal outgrowth by preventing the for

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47610
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-53816
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF7035
Species: Hu
Applications: IHC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-01383
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF756
Species: Mu
Applications: WB, IHC
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-87990
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77369
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-89435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58275
Species: Hu
Applications: WB

Publications for LZTS2 Antibody (NBP1-58275) (0)

There are no publications for LZTS2 Antibody (NBP1-58275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LZTS2 Antibody (NBP1-58275) (0)

There are no reviews for LZTS2 Antibody (NBP1-58275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LZTS2 Antibody (NBP1-58275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LZTS2 Products

Bioinformatics Tool for LZTS2 Antibody (NBP1-58275)

Discover related pathways, diseases and genes to LZTS2 Antibody (NBP1-58275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LZTS2 Antibody (NBP1-58275)

Discover more about diseases related to LZTS2 Antibody (NBP1-58275).
 

Pathways for LZTS2 Antibody (NBP1-58275)

View related products by pathway.

PTMs for LZTS2 Antibody (NBP1-58275)

Learn more about PTMs related to LZTS2 Antibody (NBP1-58275).
 

Research Areas for LZTS2 Antibody (NBP1-58275)

Find related products by research area.

Blogs on LZTS2

There are no specific blogs for LZTS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LZTS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LZTS2
Uniprot