LZTS1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit LZTS1 Antibody - BSA Free (NBP2-87763) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LZTS1. Peptide sequence: LKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKVSQKARGSHHP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LZTS1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for LZTS1 Antibody - BSA Free
Background
LZTS1, also known as leucine zipper putative tumor suppressor 1, consists of seven isoforms of sizes 66.6 kDa, 63.8 kDa, 62.9 kDa, 59.8 kDa, 55.6 kDa, 22.5 kDa, and 8.6 kDa and is involved in suppressing tumors by regulating cell growth. Diseases and disorder such as breast cancer, ovarian cancer, melanoma, esophagitis, squamous cell carcinoma, lung cancer, and prostatitis are being researched with the protein. The protein interacts in transcription, gene expression, and RNA Polymerase III transcription initiation pathways with CDK1, GTF3A, CDC25C, EEF1G, and GTF3C1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Publications for LZTS1 Antibody (NBP2-87763) (0)
There are no publications for LZTS1 Antibody (NBP2-87763).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LZTS1 Antibody (NBP2-87763) (0)
There are no reviews for LZTS1 Antibody (NBP2-87763).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LZTS1 Antibody (NBP2-87763) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LZTS1 Products
Research Areas for LZTS1 Antibody (NBP2-87763)
Find related products by research area.
|
Blogs on LZTS1