LZTS1 Antibody - BSA Free

Western Blot: LZTS1 Antibody [NBP2-87763] - Host: Rabbit. Target Name: LZTS1. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LZTS1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LZTS1. Peptide sequence: LKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKVSQKARGSHHP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LZTS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LZTS1 Antibody - BSA Free

• F37
• F37/esophageal cancer-related gene-coding leucine-zipper motifFez1
• FEZ1leucine zipper putative tumor suppressor 1
• leucine zipper, putative tumor suppressor 1

Background

LZTS1, also known as leucine zipper putative tumor suppressor 1, consists of seven isoforms of sizes 66.6 kDa, 63.8 kDa, 62.9 kDa, 59.8 kDa, 55.6 kDa, 22.5 kDa, and 8.6 kDa and is involved in suppressing tumors by regulating cell growth. Diseases and disorder such as breast cancer, ovarian cancer, melanoma, esophagitis, squamous cell carcinoma, lung cancer, and prostatitis are being researched with the protein. The protein interacts in transcription, gene expression, and RNA Polymerase III transcription initiation pathways with CDK1, GTF3A, CDC25C, EEF1G, and GTF3C1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LZTS1