LZTR1 Antibody

Images

 
Western Blot: LZTR1 Antibody [NBP2-87761] - Host: Rabbit. Target: LZTR1. Positive control (+): 293T Cell Lysate (2T). Negative control (-): A549 Cell Lysate (N03). Antibody concentration: 5ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LZTR1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human LZTR1. Peptide sequence: GFYNNRLQAYCKQNLEMNVTVQNVLQILEAADKTQALDMKRHCLHIIVHQ The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
LZTR1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for LZTR1 Antibody

  • leucine-zipper-like regulator-1
  • leucine-zipper-like transcription regulator 1
  • leucine-zipper-like transcriptional regulator 1
  • LZTR-1
  • MGC21205
  • TCFL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53420
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67618
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-49643
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, Flow-IC, KO
AF6948
Species: Hu
Applications: WB, ICC
NBP2-45780
Species: Hu
Applications: WB, IHC
NBP1-83907
Species: Hu
Applications: IHC, IHC-P
H00006925-M03
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-38528
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-02939
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF
NBP1-30565
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-215
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-21047
Species: Hu
Applications: WB, ICC/IF
H00008940-M01
Species: Hu
Applications: WB, ELISA, S-ELISA, KD
NBP1-54467
Species: Hu, Mu, Rt, Ch, Av-Du, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-77119
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
H00023119-B01P
Species: Hu
Applications: WB, ICC/IF
NB110-60928
Species: Hu, Mu, Rt, Al, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-87761
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for LZTR1 Antibody (NBP2-87761) (0)

There are no publications for LZTR1 Antibody (NBP2-87761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LZTR1 Antibody (NBP2-87761) (0)

There are no reviews for LZTR1 Antibody (NBP2-87761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LZTR1 Antibody (NBP2-87761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LZTR1 Products

Bioinformatics Tool for LZTR1 Antibody (NBP2-87761)

Discover related pathways, diseases and genes to LZTR1 Antibody (NBP2-87761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LZTR1 Antibody (NBP2-87761)

Discover more about diseases related to LZTR1 Antibody (NBP2-87761).
 

Pathways for LZTR1 Antibody (NBP2-87761)

View related products by pathway.

PTMs for LZTR1 Antibody (NBP2-87761)

Learn more about PTMs related to LZTR1 Antibody (NBP2-87761).

Blogs on LZTR1

There are no specific blogs for LZTR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LZTR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LZTR1