LZTFL1 Antibody

Images

 
Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-30690] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LZTFL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELIN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LZTFL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LZTFL1 Protein (NBP2-30690PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LZTFL1 Antibody

  • FLJ36386
  • leucine zipper transcription factor-like 1
  • leucine zipper transcription factor-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-06677
Species: Hu
H00022908-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB179
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-88689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
MAB1364
Species: Hu
Applications: Flow, CyTOF-ready
MAB8494
Species: Hu
Applications: WB, IHC, ICC
NBP1-89344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-83908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71870
Species: Hu
Applications: WB, IP, PLA
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31820
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LZTFL1 Antibody (NBP2-30690) (0)

There are no publications for LZTFL1 Antibody (NBP2-30690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LZTFL1 Antibody (NBP2-30690) (0)

There are no reviews for LZTFL1 Antibody (NBP2-30690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LZTFL1 Antibody (NBP2-30690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LZTFL1 Products

Bioinformatics Tool for LZTFL1 Antibody (NBP2-30690)

Discover related pathways, diseases and genes to LZTFL1 Antibody (NBP2-30690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LZTFL1 Antibody (NBP2-30690)

Discover more about diseases related to LZTFL1 Antibody (NBP2-30690).
 

Pathways for LZTFL1 Antibody (NBP2-30690)

View related products by pathway.

Blogs on LZTFL1

There are no specific blogs for LZTFL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LZTFL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LZTFL1
Uniprot