LZTFL1 Antibody

Images

 
Western Blot: LZTFL1 Antibody [NBP1-55520] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LZTFL1 Antibody Summary

Immunogen
Synthetic peptides corresponding to LZTFL1(leucine zipper transcription factor-like 1) The peptide sequence was selected from the C terminal of LZTFL1. Peptide sequence VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LZTFL1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LZTFL1 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LZTFL1 Antibody

  • FLJ36386
  • leucine zipper transcription factor-like 1
  • leucine zipper transcription factor-like protein 1

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00054716-Q01
Species: Hu
H00022908-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB179
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-88689
Species: Hu
Applications: WB, IHC, IHC-P
NLS2666
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Ha, Mk, Rb
Applications: ICC/IF, IHC, IHC-P
MAB1364
Species: Hu
Applications: Flow, CyTOF-ready
MAB8494
Species: Hu
Applications: WB, IHC, ICC
NBP1-89344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-69082
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NLS2666
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Ha, Mk, Rb
Applications: ICC/IF, IHC, IHC-P
NBP1-83907
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55191
Species: Hu, Mu, Rt, Bv, Eq, GP, Ze
Applications: WB
AF3635
Species: Mu
Applications: WB, IHC
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82385
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31820
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LZTFL1 Antibody (NBP1-55520) (0)

There are no publications for LZTFL1 Antibody (NBP1-55520).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LZTFL1 Antibody (NBP1-55520) (0)

There are no reviews for LZTFL1 Antibody (NBP1-55520). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LZTFL1 Antibody (NBP1-55520) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LZTFL1 Products

Bioinformatics Tool for LZTFL1 Antibody (NBP1-55520)

Discover related pathways, diseases and genes to LZTFL1 Antibody (NBP1-55520). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LZTFL1 Antibody (NBP1-55520)

Discover more about diseases related to LZTFL1 Antibody (NBP1-55520).
 

Pathways for LZTFL1 Antibody (NBP1-55520)

View related products by pathway.

Blogs on LZTFL1

There are no specific blogs for LZTFL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LZTFL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LZTFL1
Uniprot