![Western Blot: LZIC Antibody [H00084328-B01P] - Analysis of LZIC expression in human liver.](http://images.novusbio.com/fullsize/LZIC-Antibody-Western-Blot-H00084328-B01P-img0004.jpg "Western Blot: LZIC Antibody [H00084328-B01P] - Analysis of LZIC expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse LZIC Antibody - Azide and BSA Free (H00084328-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | LZIC (NP_115744, 1 a.a. - 190 a.a.) full-length human protein. MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK |
| Specificity | LZIC - leucine zipper and CTNNBIP1 domain containing, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | LZIC |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LZIC Antibody (H00084328-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: LZIC Antibody [H00084328-B01P] - Analysis of LZIC expression in K-562.](http://images.novusbio.com/fullsize/LZIC-Antibody-Western-Blot-H00084328-B01P-img0003.jpg "Western Blot: LZIC Antibody [H00084328-B01P] - Analysis of LZIC expression in K-562.")
![Western Blot: LZIC Antibody [H00084328-B01P] - Analysis of LZIC expression in transfected 293T cell line by LZIC polyclonal antibody. Lane 1: LZIC transfected lysate(20.9 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LZIC-Antibody-Western-Blot-H00084328-B01P-img0005.jpg "Western Blot: LZIC Antibody [H00084328-B01P] - Analysis of LZIC expression in transfected 293T cell line by LZIC polyclonal antibody. Lane 1: LZIC transfected lysate(20.9 KDa). Lane 2: Non-transfected lysate.")
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")