Lymphotoxin beta/TNFSF3 Recombinant Protein Antigen

Images

 
There are currently no images for Lymphotoxin beta/TNFSF3 Protein (NBP2-14207PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lymphotoxin beta/TNFSF3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LTB.

Source: E. coli

Amino Acid Sequence: GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LTB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14207.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lymphotoxin beta/TNFSF3 Recombinant Protein Antigen

  • LTB
  • lymphotoxin beta (TNF superfamily, member 3)
  • Lymphotoxin beta
  • lymphotoxin-beta
  • p33
  • TNFCTNF-C
  • TNFSF3
  • TNFSF3LT-beta
  • Tumor necrosis factor C
  • Tumor necrosis factor ligand superfamily member 3

Background

Tumor necrosis factor (TNF) and lymphotoxin-alpha (LT-alpha, also known as TNF beta) are members of a family of secreted and cell surface cytokines that participate in the regulation of immune and inflammatory responses. LT-beta (lymphotaxin-beta or tumor necrosis factor C) is a type II membrane protein with significant homology to TNF, LT-alpha, and the ligand for the CD40 receptor. LT-alpha is present on the surface of activated T, B, and LAK cells as a complex with the 33 kda glycoprotein, LT-beta. LT-beta, also expressed by active lymphocytes, forms a heterotrimer with LT-a on the cell surface and anchors LT-alpha to the cell surface. A TNF receptor-related protein, the LT-beta receptor (also known as TNFC receptor), is the human receptor for the LT-alpha/LT-beta heterotrimer. There are two LT-beta isoforms expressed in human lymphoid cell lines and non-Hodgkin's lymphomas. The gene which encodes LT-beta maps to the major histocompatibility complex region on human chromosome 6p21.3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

211-TBB/CF
Species: Hu
Applications: BA
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
NBP2-27422
Species: Hu, Pm
Applications: Flow, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
6507-IL/CF
Species: Hu
Applications: BA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
485-MI
Species: Mu
Applications: BA
NBP1-89790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DRT100
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
NBP2-14207PEP
Species: Hu
Applications: AC

Publications for Lymphotoxin beta/TNFSF3 Protein (NBP2-14207PEP) (0)

There are no publications for Lymphotoxin beta/TNFSF3 Protein (NBP2-14207PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lymphotoxin beta/TNFSF3 Protein (NBP2-14207PEP) (0)

There are no reviews for Lymphotoxin beta/TNFSF3 Protein (NBP2-14207PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lymphotoxin beta/TNFSF3 Protein (NBP2-14207PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lymphotoxin beta/TNFSF3 Products

Blogs on Lymphotoxin beta/TNFSF3

There are no specific blogs for Lymphotoxin beta/TNFSF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lymphotoxin beta/TNFSF3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LTB