LYK5 Antibody [Alexa Fluor® 750]

• Reactivity: Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Alexa Fluor 750

LYK5 Antibody [Alexa Fluor® 750] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-210 of human LYK5 (NP_699166.2).
  
  Sequence:
  FLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STRADA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for LYK5 Antibody [Alexa Fluor® 750]

• LYK5FLJ90524
• NY-BR-96
• protein kinase LYK5
• Serologically defined breast cancer antigen NY-BR-96
• STE20-like pseudokinase
• STE20-related adapter protein
• STE20-related adaptor protein
• STE20-related kinase adapter protein alpha
• STE20-related kinase adaptor alpha
• Stlk
• STRAD alpha
• STRADPMSE

Background

The protein encoded by the LYK5 gene contains a STE20-like kinase domain, but lacks several residues that are critical forcatalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex withserine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39,also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has beenshown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcriptvariants encoding different isoforms have been found for this gene. Additional transcript variants have been describedbut their full-length nature is not known. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STRADA