Ly6K Antibody (CL2433)

Images

 
Western Blot: Ly6K Antibody (CL2433) [NBP2-36763] - Lane 1: Marker [kDa]. Lane 2: Human testis tissue lysate
Immunohistochemistry-Paraffin: Ly6K Antibody (CL2433) [NBP2-36763] - Staining of human liver shows absence of immunoreactivity.
Immunohistochemistry-Paraffin: Ly6K Antibody (CL2433) [NBP2-36763] - Staining of human testis shows strong cytoplasmic immunoreactivity in a subset of cells in seminiferous tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL2433
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ly6K Antibody (CL2433) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG
Specificity
Specificity of human Ly6K antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
LY6K
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Ly6K Lysate (NBP2-65382)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Ly6K Antibody (CL2433)

  • cancer/testis antigen 97
  • CO16
  • CT97
  • FLJ35226
  • HSJ001348
  • Ly6K
  • ly-6K
  • lymphocyte antigen 6 complex, locus K
  • lymphocyte antigen 6K

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6028
Species: Hu
Applications: WB, IHC
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75542
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84357
Species: Hu
Applications: WB, IHC, IHC-P
AF7028
Species: Mu, Rt
Applications: WB, ICC
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, IHC-P (-)
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
MAB7636
Species: Hu
Applications: IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36763
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ly6K Antibody (NBP2-36763) (0)

There are no publications for Ly6K Antibody (NBP2-36763).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly6K Antibody (NBP2-36763) (0)

There are no reviews for Ly6K Antibody (NBP2-36763). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly6K Antibody (NBP2-36763) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Ly6K Antibody (NBP2-36763)

Discover related pathways, diseases and genes to Ly6K Antibody (NBP2-36763). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ly6K Antibody (NBP2-36763)

Discover more about diseases related to Ly6K Antibody (NBP2-36763).
 

Pathways for Ly6K Antibody (NBP2-36763)

View related products by pathway.

PTMs for Ly6K Antibody (NBP2-36763)

Learn more about PTMs related to Ly6K Antibody (NBP2-36763).

Blogs on Ly6K

There are no specific blogs for Ly6K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ly6K Antibody (CL2433) and receive a gift card or discount.

Bioinformatics

Gene Symbol LY6K
Entrez
Uniprot