Recombinant Human Ly-6E Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Ly-6E Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 131 of Human LY6E full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
LY6E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
39.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ly-6E Protein

  • Ly6E
  • Ly-6E
  • lymphocyte antigen 6 complex, locus E
  • Retinoic acid-induced gene E protein
  • RIGE
  • RIGE9804
  • RIG-Ely-6E
  • SCA2
  • SCA2Ly-6E
  • SCA-2lymphocyte antigen 6E
  • Stem cell antigen 2
  • Thymic shared antigen 1
  • TSA1
  • TSA-1retinoic acid induced gene E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB110-58346
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-49081
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ly-6E Recombinant Protein (H00004061-P01) (0)

There are no publications for Ly-6E Recombinant Protein (H00004061-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly-6E Recombinant Protein (H00004061-P01) (0)

There are no reviews for Ly-6E Recombinant Protein (H00004061-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly-6E Recombinant Protein (H00004061-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ly-6E Products

Bioinformatics Tool for Ly-6E Recombinant Protein (H00004061-P01)

Discover related pathways, diseases and genes to Ly-6E Recombinant Protein (H00004061-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ly-6E Recombinant Protein (H00004061-P01)

Discover more about diseases related to Ly-6E Recombinant Protein (H00004061-P01).
 

Pathways for Ly-6E Recombinant Protein (H00004061-P01)

View related products by pathway.

PTMs for Ly-6E Recombinant Protein (H00004061-P01)

Learn more about PTMs related to Ly-6E Recombinant Protein (H00004061-P01).
 

Research Areas for Ly-6E Recombinant Protein (H00004061-P01)

Find related products by research area.

Blogs on Ly-6E

There are no specific blogs for Ly-6E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Ly-6E Antibody
NBP1-52176

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ly-6E Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LY6E
Entrez