Recombinant Human Lubricin/PRG4 Protein

Images

 
SDS-Page: Recombinant Human Proteoglycan 4 Protein [H00010216-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Lubricin/PRG4 Peptides and Proteins

Order Details


    • Catalog Number
      H00010216-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Lubricin/PRG4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1305-1404 of Human PRG4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRG4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00010216-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Lubricin/PRG4 Protein

  • bG174L6.2 (MSF: megakaryocyte stimulating factor )
  • bG174L6.2
  • CACP
  • FLJ32635
  • JCAP
  • lubricin
  • megakaryocyte stimulating factor
  • Megakaryocyte-stimulating factor
  • MSFproteoglycan 4, (megakaryocyte stimulating factor, articular superficial zoneprotein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome)
  • proteoglycan 4
  • Superficial zone proteoglycan
  • SZPHAPOarticular superficial zone protein

Background

PRG4 - proteoglycan 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20823
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-34048
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00010216-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01)(1)

Reviews for Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01) (0)

There are no reviews for Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lubricin/PRG4 Products

Bioinformatics Tool for Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01)

Discover related pathways, diseases and genes to Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01)

Discover more about diseases related to Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01).
 

Pathways for Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01)

View related products by pathway.

PTMs for Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01)

Learn more about PTMs related to Lubricin/PRG4 Partial Recombinant Protein (H00010216-Q01).

Blogs on Lubricin/PRG4

There are no specific blogs for Lubricin/PRG4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Lubricin/PRG4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRG4