Lubricin/PRG4 Antibody

Images

 
Immunohistochemistry-Paraffin: Lubricin/PRG4 Antibody [NBP1-89984] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lubricin/PRG4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNC
Specificity
Specificity of human Lubricin/PRG4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lubricin/PRG4 Antibody

  • bG174L6.2 (MSF: megakaryocyte stimulating factor )
  • bG174L6.2
  • CACP
  • FLJ32635
  • JCAP
  • lubricin
  • megakaryocyte stimulating factor
  • Megakaryocyte-stimulating factor
  • MSFproteoglycan 4, (megakaryocyte stimulating factor, articular superficial zoneprotein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome)
  • proteoglycan 4
  • Superficial zone proteoglycan
  • SZPHAPOarticular superficial zone protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89076
Species: Hu, Ca
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1793
Species: Hu, Mu, Mk
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
7270-IL/CF
Species: Hu
NBP2-67511
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
NB100-1519
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA
NBP2-34048
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP1-89984
Species: Hu
Applications: IHC, IHC-P

Publications for Lubricin/PRG4 Antibody (NBP1-89984) (0)

There are no publications for Lubricin/PRG4 Antibody (NBP1-89984).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lubricin/PRG4 Antibody (NBP1-89984) (0)

There are no reviews for Lubricin/PRG4 Antibody (NBP1-89984). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lubricin/PRG4 Antibody (NBP1-89984) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Lubricin/PRG4 Products

Bioinformatics Tool for Lubricin/PRG4 Antibody (NBP1-89984)

Discover related pathways, diseases and genes to Lubricin/PRG4 Antibody (NBP1-89984). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lubricin/PRG4 Antibody (NBP1-89984)

Discover more about diseases related to Lubricin/PRG4 Antibody (NBP1-89984).
 

Pathways for Lubricin/PRG4 Antibody (NBP1-89984)

View related products by pathway.

PTMs for Lubricin/PRG4 Antibody (NBP1-89984)

Learn more about PTMs related to Lubricin/PRG4 Antibody (NBP1-89984).

Blogs on Lubricin/PRG4

There are no specific blogs for Lubricin/PRG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lubricin/PRG4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRG4