LSM4 Antibody - BSA Free

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846] - Staining of human Testis shows moderate granular cytoplasmic and nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846] - Staining of human cerevral cortex shows strong granular cycoplasmic positivity

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Staining of human Pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LSM4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LSM4 Antibody - BSA Free (NBP1-86846) is a polyclonal antibody validated for use in IHC. Anti-LSM4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIID
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LSM4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LSM4 Protein (NBP1-86846PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LSM4 Antibody - BSA Free

• Glycine-rich protein
• GRP
• LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• U6 snRNA-associated Sm-like protein LSm4
• YER112W

Background

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LSM4 Antibody (NBP1-86846)(1)

Publication using NBP1-86846

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: LSM4