LSM14A Antibody - Azide and BSA Free

Western Blot: LSM14A Antibody [H00026065-B01P] - Analysis of LSM14A expression in human placenta.

Western Blot: LSM14A Antibody [H00026065-B01P] - Analysis of LSM14A expression in transfected 293T cell line by LSM14A polyclonal antibody. Lane 1: LSM14A transfected lysate(50.93 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LSM14A Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LSM14A Antibody - Azide and BSA Free (H00026065-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-LSM14A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LSM14A (AAH16842.1, 1 a.a. - 463 a.a.) full-length human protein. MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: LSM14A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful in Western Blot. Immunocytochemistry/Immunofluorescence was reported in scientific literature.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LSM14A Antibody - Azide and BSA Free

• alphaSNBP
• C19orf13
• DKFZP434D1335
• FAM61A
• family with sequence similarity 61, member A
• hRAP55
• hRAP55A
• LSM14 homolog A
• LSM14A, SCD6 homolog A (S. cerevisiae)
• Protein FAM61A
• protein LSM14 homolog A
• Protein SCD6 homolog
• Putative alpha-synuclein-binding protein
• RAP55ALSM14 homolog A (SCD6, S. cerevisiae)
• RAP55chromosome 19 open reading frame 13
• RNA-associated protein 55
• RNA-associated protein 55A

Background

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LSM14A Antibody (H00026065-B01P)(1)

Publication using H00026065-B01P

• Perez-Vilaro G, Scheller N, Saludes V et al. Hepatitis C virus infection alters P-body composition but is independent of P-body granules. J Virol 2012-08-01 [PMID: 22674998] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: LSM14A
• Uniprot:
  • AAH16842.1(Human)