Recombinant Human LRRFIP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LRRFIP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-105 of Human LRRFIP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ

Protein/Peptide Type
Recombinant Protein
Gene
LRRFIP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRRFIP1 Protein

  • FLAP-1
  • FLIIAP1
  • GC-binding factor 2
  • GCF2
  • GCF-2
  • HUFI-1
  • leucine rich repeat (in FLII) interacting protein 1
  • leucine-rich repeat flightless-interacting protein 1
  • LRR FLII-interacting protein 1
  • MGC10947
  • MGC119738
  • MGC119739
  • NEDD8-conjugating enzyme
  • TRIPTAR RNA-interacting protein

Background

LRRFIP1( AAH10662, 1 a.a. - 106 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-03822
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27199
Species: Hu, Eq, Pm
Applications: IHC-P
NBP1-59632
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP1-55035
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
H00009208-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for LRRFIP1 Recombinant Protein (H00009208-P01) (0)

There are no publications for LRRFIP1 Recombinant Protein (H00009208-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRFIP1 Recombinant Protein (H00009208-P01) (0)

There are no reviews for LRRFIP1 Recombinant Protein (H00009208-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRFIP1 Recombinant Protein (H00009208-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRRFIP1 Products

Bioinformatics Tool for LRRFIP1 Recombinant Protein (H00009208-P01)

Discover related pathways, diseases and genes to LRRFIP1 Recombinant Protein (H00009208-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRFIP1 Recombinant Protein (H00009208-P01)

Discover more about diseases related to LRRFIP1 Recombinant Protein (H00009208-P01).
 

Pathways for LRRFIP1 Recombinant Protein (H00009208-P01)

View related products by pathway.

PTMs for LRRFIP1 Recombinant Protein (H00009208-P01)

Learn more about PTMs related to LRRFIP1 Recombinant Protein (H00009208-P01).

Blogs on LRRFIP1

There are no specific blogs for LRRFIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LRRFIP1 Antibody
NBP2-24672

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LRRFIP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRFIP1