LRRC67 Antibody

Western Blot: LRRC67 Antibody [NBP1-84048] - Analysis using Anti-PPP1R42 antibody NBP1-84048 (A) shows similar pattern to independent antibody NBP1-84047 (B).

Immunohistochemistry-Paraffin: LRRC67 Antibody [NBP1-84048] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Discontinued

LRRC67 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRTL
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP1R42
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LRRC67 Antibody

• dtr
• leucine rich repeat containing 67
• leucine-rich repeat-containing protein 67

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R42