LRP10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRP10 Antibody [NBP1-84159] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRP10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRP10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRP10 Antibody

  • DKFZp564C1940
  • low density lipoprotein receptor-related protein 10
  • low-density lipoprotein receptor-related protein 10
  • LRP-10
  • LRP9
  • MGC142274
  • MGC142276
  • MGC8675
  • MST087

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-14988
Species: Hu, Mu
Applications: WB
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP2-67286
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC, IHC-P
AF2209
Species: Hu
Applications: WB, ELISA, IHC
MAB5948
Species: Hu
Applications: WB, Flow, IHC
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
AF5699
Species: Hu, Mu
Applications: WB, IHC
AF2560
Species: Hu
Applications: WB
NBP1-84159
Species: Hu
Applications: ICC/IF

Publications for LRP10 Antibody (NBP1-84159) (0)

There are no publications for LRP10 Antibody (NBP1-84159).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP10 Antibody (NBP1-84159) (0)

There are no reviews for LRP10 Antibody (NBP1-84159). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRP10 Antibody (NBP1-84159) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRP10 Products

Bioinformatics Tool for LRP10 Antibody (NBP1-84159)

Discover related pathways, diseases and genes to LRP10 Antibody (NBP1-84159). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRP10 Antibody (NBP1-84159)

Discover more about diseases related to LRP10 Antibody (NBP1-84159).
 

Pathways for LRP10 Antibody (NBP1-84159)

View related products by pathway.

PTMs for LRP10 Antibody (NBP1-84159)

Learn more about PTMs related to LRP10 Antibody (NBP1-84159).

Blogs on LRP10

There are no specific blogs for LRP10, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRP10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP10