LRCH1 Antibody

Images

 
Western Blot: LRCH1 Antibody [NBP1-90629] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: LRCH1 Antibody [NBP1-90629] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli, cytosol & actin filaments.
Immunohistochemistry-Paraffin: LRCH1 Antibody [NBP1-90629] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRCH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKATTAEDC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRCH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRCH1 Protein (NBP1-90629PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRCH1 Antibody

  • CHDC1
  • FLJ41660
  • KIAA1016
  • leucine-rich repeat and calponin homology domain-containing protein 1
  • leucine-rich repeats and calponin homology (CH) domain containing 1
  • neuronal protein 81
  • NP81

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF853
Species: Mu
Applications: WB, IHC
NBP1-85616
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PEP-ELISA, ICC
AF592
Species: Mu
Applications: WB, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29950
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP1-28487
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for LRCH1 Antibody (NBP1-90629) (0)

There are no publications for LRCH1 Antibody (NBP1-90629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRCH1 Antibody (NBP1-90629) (0)

There are no reviews for LRCH1 Antibody (NBP1-90629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRCH1 Antibody (NBP1-90629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRCH1 Products

Bioinformatics Tool for LRCH1 Antibody (NBP1-90629)

Discover related pathways, diseases and genes to LRCH1 Antibody (NBP1-90629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRCH1 Antibody (NBP1-90629)

Discover more about diseases related to LRCH1 Antibody (NBP1-90629).
 

Pathways for LRCH1 Antibody (NBP1-90629)

View related products by pathway.

Blogs on LRCH1

There are no specific blogs for LRCH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRCH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRCH1