LOXL4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LOXL4 Antibody [NBP2-32692] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.

Product Discontinued

LOXL4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMN
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LOXL4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: IHC-P, Retrieval method: HIER pH6. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.

Reactivity Notes

Use in Mouse reported in scientific publication (PMID: 32424143).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LOXL4 Antibody - BSA Free

• EC 1.4.3
• EC 1.4.3.-
• FLJ21889
• LOX L4
• LOXC
• LOXClysyl oxidase related C
• LOXL4
• lysyl oxidase homolog 4
• lysyl oxidase-like 4
• Lysyl oxidase-like protein 4
• Lysyl oxidase-related protein C

Background

LOXL4 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LOXL4 Antibody (NBP2-32692)(2)

Publications using NBP2-32692

• Jiang C, Wang M, Yao W et al. Comprehensive Analysis on Prognosis and Immune Infiltration of Lysyl Oxidase Family Members in Pancreatic Adenocarcinoma With Experimental Verification Frontiers in Molecular Biosciences 2022-04-01 [PMID: 35433829] (Immunohistochemistry, Mouse)
• Yu H, Ding J, Zhu H et al. LOXL1 confers antiapoptosis and promotes gliomagenesis through stabilizing BAG2 Cell Death Differ. 2020-05-18 [PMID: 32424143] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: LOXL4