Immunocytochemistry/ Immunofluorescence: LOXL4 Antibody [NBP2-32692] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human kidney shows strong positivity in extracellular matrix of renal tubules.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human placenta shows strong positivity in extracellular matrix of the trophoblast.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human testis shows moderate to strong positivity in extracellular matrix of peritubular myoid cells.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Novus Biologicals Rabbit LOXL4 Antibody - BSA Free (NBP2-32692) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-LOXL4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMN
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LOXL4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in Mouse reported in scientific publication (PMID: 32424143).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for LOXL4 Antibody - BSA Free
EC 1.4.3
EC 1.4.3.-
FLJ21889
LOX L4
LOXC
LOXClysyl oxidase related C
LOXL4
lysyl oxidase homolog 4
lysyl oxidase-like 4
Lysyl oxidase-like protein 4
Lysyl oxidase-related protein C
Background
LOXL4 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our LOXL4 Antibody - BSA Free and receive a gift card or discount.