LOXL4 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: LOXL4 Antibody [NBP2-32692] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human kidney shows strong positivity in extracellular matrix of renal tubules.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human placenta shows strong positivity in extracellular matrix of the trophoblast.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human testis shows moderate to strong positivity in extracellular matrix of peritubular myoid cells.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Representative immunohistochemistry of LOXs in PDAC tissues and normal pancreas tissues. (A) IHC staining of LOX and quantification showed higher expression in PDAC than normal pancreas tissues. (B) IHC staining and ...read more
Representative immunohistochemistry of LOXs in PDAC tissues and normal pancreas tissues. (A) IHC staining of LOX and quantification showed higher expression in PDAC than normal pancreas tissues. (B) IHC staining and ...read more

Product Details

Summary
Product Discontinued
View other related LOXL4 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-32692
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LOXL4 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMN
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LOXL4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC-P, Retrieval method: HIER pH6. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Publications
Read Publications using
NBP2-32692 in the following applications:

Reactivity Notes

Use in Mouse reported in scientific publication (PMID: 32424143).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LOXL4 Antibody - BSA Free

  • EC 1.4.3
  • EC 1.4.3.-
  • FLJ21889
  • LOX L4
  • LOXC
  • LOXClysyl oxidase related C
  • LOXL4
  • lysyl oxidase homolog 4
  • lysyl oxidase-like 4
  • Lysyl oxidase-like protein 4
  • Lysyl oxidase-related protein C

Background

LOXL4 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2527
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-75964
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00004016-D01P
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
NBP1-32954
Species: Fe, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
6507-IL/CF
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA
MAB5170
Species: Hu
Applications: Block, Simple Western, WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB

Publications for LOXL4 Antibody (NBP2-32692)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IF/IHC, Immunohistochemistry.


Filter By Application
IF/IHC
(1)
Immunohistochemistry
(1)
All Applications
Filter By Species
Mouse
(2)
All Species

Reviews for LOXL4 Antibody (NBP2-32692) (0)

There are no reviews for LOXL4 Antibody (NBP2-32692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LOXL4 Antibody (NBP2-32692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LOXL4 Products

Research Areas for LOXL4 Antibody (NBP2-32692)

Find related products by research area.

Blogs on LOXL4

There are no specific blogs for LOXL4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LOXL4 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol LOXL4