LOXL4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LOXL4 Antibody [NBP2-32692] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human kidney shows strong positivity in extracellular matrix of renal tubules.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human placenta shows strong positivity in extracellular matrix of the trophoblast.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human testis shows moderate to strong positivity in extracellular matrix of peritubular myoid cells.
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LOXL4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMN
Specificity
Specificity of human LOXL4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LOXL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC-P, Retrieval method: HIER pH6. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
LOXL4 Protein (NBP2-32692PEP)
Publications
Read Publication using
NBP2-32692 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Use in Mouse reported in scientific publication (PMID: 32424143).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LOXL4 Antibody

  • EC 1.4.3
  • EC 1.4.3.-
  • FLJ21889
  • LOX L4
  • LOXC
  • LOXClysyl oxidase related C
  • LOXL4
  • lysyl oxidase homolog 4
  • lysyl oxidase-like 4
  • Lysyl oxidase-like protein 4
  • Lysyl oxidase-related protein C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2527
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-75964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004016-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NBP1-32954
Species: Hu, Mu, Fe
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF1060
Species: Mu
Applications: WB, Simple Western, IHC, ELISA(Cap), ELISA(Det)
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB400-104
Species: Hu, Mu, Rt, Po, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, KD, KO
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
7954-GM/CF
Species: Hu
NBP2-75442
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-88941
Species: Hu
Applications: IHC, IHC-P

Publications for LOXL4 Antibody (NBP2-32692)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for LOXL4 Antibody (NBP2-32692) (0)

There are no reviews for LOXL4 Antibody (NBP2-32692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LOXL4 Antibody (NBP2-32692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LOXL4 Products

Bioinformatics Tool for LOXL4 Antibody (NBP2-32692)

Discover related pathways, diseases and genes to LOXL4 Antibody (NBP2-32692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LOXL4 Antibody (NBP2-32692)

Discover more about diseases related to LOXL4 Antibody (NBP2-32692).
 

Pathways for LOXL4 Antibody (NBP2-32692)

View related products by pathway.

PTMs for LOXL4 Antibody (NBP2-32692)

Learn more about PTMs related to LOXL4 Antibody (NBP2-32692).
 

Research Areas for LOXL4 Antibody (NBP2-32692)

Find related products by research area.

Blogs on LOXL4

There are no specific blogs for LOXL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LOXL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LOXL4