LMTK3 Antibody (1E1) - Azide and BSA Free Summary
| Immunogen |
LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG |
| Localization |
Cell Membrane |
| Specificity |
LMTK3 - lemur tyrosine kinase 3 |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
LMTK3 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for LMTK3 Antibody (1E1) - Azide and BSA Free
Background
LMTK3, or Lemur Tyrosine Kinase 3, consists of a 1,460 amino acid isoform that is 153,661 kDa, and is considered a membrane protein, though its function is not known. Current research is being conducted on the relationship between LMTK3 and a variety of diseases and disorders, including uterine sarcoma, pancreatitis, thyroid carcinoma, adenocarcinoma, breast cancer, and thyroiditis. LMTK3 has been linked to Paxillin interactions, intracellular calcium signaling, MAPK signaling, Akt signaling, the GPCR pathway, and the Endothelin-1 signaling pathway. The protein interacts with ZBTB16 and PPP1CA.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Hu
Applications: Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Hu
Applications: IHC, Neut, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Publications for LMTK3 Antibody (H00114783-M01) (0)
There are no publications for LMTK3 Antibody (H00114783-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LMTK3 Antibody (H00114783-M01) (0)
There are no reviews for LMTK3 Antibody (H00114783-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LMTK3 Antibody (H00114783-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LMTK3 Products
Research Areas for LMTK3 Antibody (H00114783-M01)
Find related products by research area.
|
Blogs on LMTK3