Novus Biologicals products are now on bio-techne.com

LMTK3 Antibody (1E1)

Images

 
Sandwich ELISA: LMTK3 Antibody (1E1) [H00114783-M01] - Detection limit for recombinant GST tagged LMTK3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LMTK3 Antibody (1E1) Summary

Immunogen
LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG
Localization
Cell Membrane
Specificity
LMTK3 - lemur tyrosine kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LMTK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMTK3 Antibody (1E1)

  • AATYK3
  • EC 2.7.11.1
  • KIAA1883
  • lemur tyrosine kinase 3KIAA1883TYKLM3LMR3
  • LMR3
  • LMTK3
  • PPP1R101
  • serine/threonine-protein kinase LMTK3
  • TYKLM3

Background

LMTK3, or Lemur Tyrosine Kinase 3, consists of a 1,460 amino acid isoform that is 153,661 kDa, and is considered a membrane protein, though its function is not known. Current research is being conducted on the relationship between LMTK3 and a variety of diseases and disorders, including uterine sarcoma, pancreatitis, thyroid carcinoma, adenocarcinoma, breast cancer, and thyroiditis. LMTK3 has been linked to Paxillin interactions, intracellular calcium signaling, MAPK signaling, Akt signaling, the GPCR pathway, and the Endothelin-1 signaling pathway. The protein interacts with ZBTB16 and PPP1CA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
AF1016
Species: Hu
Applications: Neut, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
AF641
Species: Mu
Applications: IHC, WB
NBP3-16473
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF1042
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
MAB3291
Species: Hu
Applications: IHC, Neut, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
AF321
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-52813
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
AF2000
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB4260
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB

Publications for LMTK3 Antibody (H00114783-M01) (0)

There are no publications for LMTK3 Antibody (H00114783-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMTK3 Antibody (H00114783-M01) (0)

There are no reviews for LMTK3 Antibody (H00114783-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMTK3 Antibody (H00114783-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMTK3 Products

Array H00114783-M01

Research Areas for LMTK3 Antibody (H00114783-M01)

Find related products by research area.

Blogs on LMTK3

There are no specific blogs for LMTK3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMTK3 Antibody (1E1) and receive a gift card or discount.

Bioinformatics

Gene Symbol LMTK3
Entrez
Uniprot