LMP7/PSMB8 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396] - Staining in human lymph node and pancreas tissues using anti-PSMB8 antibody. Corresponding PSMB8 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396] - Staining of human colon, kidney, liver and lymph node using Anti-PSMB8 antibody NBP2-47396 (A) shows similar protein ...read more
Western Blot: LMP7/PSMB8 Antibody [NBP2-47396] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396] - Staining of human kidney.
Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396] - Staining of human liver.
Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody [NBP2-47396] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMP7/PSMB8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMB8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LMP7/PSMB8 Protein (NBP2-47396PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMP7/PSMB8 Antibody

  • ALDD
  • beta5i
  • D6S216E
  • EC 3.4.25.1
  • JMP
  • LMP7
  • LMP7MGC1491
  • Low molecular mass protein 7
  • low molecular weight protein 7
  • Macropain subunit C13
  • Multicatalytic endopeptidase complex subunit C13
  • NKJO
  • protease component C13
  • proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalpeptidase 7)
  • proteasome catalytic subunit 3i
  • Proteasome Component C13
  • proteasome subunit beta 5i
  • proteasome subunit beta type-8
  • Proteasome subunit beta-5i
  • Proteasome Subunit Y2
  • proteasome-related gene 7
  • PSMB5i
  • PSMB5iD6S216
  • PSMB8
  • Really interesting new gene 10 protein
  • RING10
  • RING10proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalprotease 7)
  • Y2

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-05167
Species: Hu
Applications: ELISA, IHC, IHC-P, ELISA(Cap), S-ELISA
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88660
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
285-IF
Species: Hu
Applications: BA
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00008615-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1538
Species: Ha, Hu, Rt
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
NBP1-83121
Species: Hu
Applications: IHC, IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for LMP7/PSMB8 Antibody (NBP2-47396) (0)

There are no publications for LMP7/PSMB8 Antibody (NBP2-47396).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMP7/PSMB8 Antibody (NBP2-47396) (0)

There are no reviews for LMP7/PSMB8 Antibody (NBP2-47396). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMP7/PSMB8 Antibody (NBP2-47396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMP7/PSMB8 Products

Bioinformatics Tool for LMP7/PSMB8 Antibody (NBP2-47396)

Discover related pathways, diseases and genes to LMP7/PSMB8 Antibody (NBP2-47396). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMP7/PSMB8 Antibody (NBP2-47396)

Discover more about diseases related to LMP7/PSMB8 Antibody (NBP2-47396).
 

Pathways for LMP7/PSMB8 Antibody (NBP2-47396)

View related products by pathway.

PTMs for LMP7/PSMB8 Antibody (NBP2-47396)

Learn more about PTMs related to LMP7/PSMB8 Antibody (NBP2-47396).
 

Research Areas for LMP7/PSMB8 Antibody (NBP2-47396)

Find related products by research area.

Blogs on LMP7/PSMB8

There are no specific blogs for LMP7/PSMB8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMP7/PSMB8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB8