LMO7 Antibody - BSA Free

Western Blot: LMO7 Antibody [NBP3-09978] - Western blot analysis of LMO7 in Human HepG2 Whole Cell. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LMO7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LMO7 Antibody - BSA Free (NBP3-09978) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LMO7 (NP_001293009.1). Peptide sequence VEPKTALPFNRFLPNKSRQPSYVPAPLRKKKPDKHEDNRRSWASPVYTEA
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LMO7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 193 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LMO7 Antibody - BSA Free

• FBX20F-box only protein 20
• KIAA0858FBXO20F-box protein Fbx20
• LIM domain 7
• LIM domain only 7
• LIM domain only protein 7
• LMO-7
• LOMP
• zinc-finger domain-containing protein

Background

LMO7 contains a calponin homology (CH) domain, a PDZ domain, and a LIM domain. An F-box (FBX) domain is present in alternative splice variants. Members of the LIM protein family carry the LIM domain, a unique cysteine-rich zinc-binding domain. Members of the FBX protein family are involved in protein-protein interactions. The encoded protein may be involved in protein-protein interactions. Multiple alternative splice variants have been described but their full-length sequences have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMO7