LMO7 Antibody (4B4) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: LMO7 Antibody (4B4) [H00004008-M01] - Analysis of monoclonal antibody to LMO7 on HeLa cell . Antibody concentration 10 ug/ml.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 4B4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LMO7 Antibody (4B4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: LMO7 (NP_005349, 453 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATYPSEIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSP
• Specificity: LMO7 (4B4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LMO7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMO7 Antibody (4B4) - Azide and BSA Free

• FBX20F-box only protein 20
• KIAA0858FBXO20F-box protein Fbx20
• LIM domain 7
• LIM domain only 7
• LIM domain only protein 7
• LMO-7
• LOMP
• zinc-finger domain-containing protein

Background

This gene encodes a protein containing a calponin homology (CH) domain, a PDZ domain, and a LIM domain. An F-box (FBX) domain is present in alternative splice variants. Members of the LIM protein family carry the LIM domain, a unique cysteine-rich zinc-binding domain. Members of the FBX protein family are involved in protein-protein interactions. The encoded protein may be involved in protein-protein interactions. Multiple alternative splice variants have been described but their full-length sequences have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LMO7
• Entrez:
  • 4008(Human)
• OMIM:
  • 604362(Human)
• Uniprot:
  • NP_005349(Human)