Recombinant Human LMO4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LMO4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-165 of Human LMO4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
LMO4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LMO4 Protein

  • Breast tumor autoantigen
  • Crp3
  • Etohi4
  • LIM domain only 4
  • LIM domain only protein 4
  • LIM domain transcription factor LMO4
  • LMO4
  • LMO-4

Background

LMO4( AAH17673, 1 a.a. - 166 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NB110-83978
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004004-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
H00055885-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2458
Species: Mu
Applications: WB, IHC
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00008543-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for LMO4 Recombinant Protein (H00008543-P01) (0)

There are no publications for LMO4 Recombinant Protein (H00008543-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO4 Recombinant Protein (H00008543-P01) (0)

There are no reviews for LMO4 Recombinant Protein (H00008543-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMO4 Recombinant Protein (H00008543-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMO4 Products

Bioinformatics Tool for LMO4 Recombinant Protein (H00008543-P01)

Discover related pathways, diseases and genes to LMO4 Recombinant Protein (H00008543-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMO4 Recombinant Protein (H00008543-P01)

Discover more about diseases related to LMO4 Recombinant Protein (H00008543-P01).
 

Pathways for LMO4 Recombinant Protein (H00008543-P01)

View related products by pathway.

PTMs for LMO4 Recombinant Protein (H00008543-P01)

Learn more about PTMs related to LMO4 Recombinant Protein (H00008543-P01).
 

Research Areas for LMO4 Recombinant Protein (H00008543-P01)

Find related products by research area.

Blogs on LMO4

There are no specific blogs for LMO4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LMO4 Antibody
NBP2-43538
BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LMO4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO4
Entrez