LMO4 Recombinant Protein Antigen

Images

 
There are currently no images for LMO4 Recombinant Protein Antigen (NBP2-49342PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LMO4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMO4.

Source: E. coli

Amino Acid Sequence: FTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LMO4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49342.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMO4 Recombinant Protein Antigen

  • Breast tumor autoantigen
  • Crp3
  • Etohi4
  • LIM domain only 4
  • LIM domain only protein 4
  • LIM domain transcription factor LMO4
  • LMO4
  • LMO-4

Background

The LIM-only (LMO) proteins, LMO1 and LMO2, are nuclear factors that are characterized by a conserved LIM domain. The LIM domain consists of a cysteine-rich zinc-binding motif that is present in a variety of transcription factors, including the LIM homeobox (LHX) proteins expressed in the central nervous system and involved in cell differentiation. LMO1 and LMO2 are expressed in the adult CNS in a cell type-specific manner, where they are differentially regulated by neuronal activity and are involved in regulating the cellular differentiated phenotype of neurons. LMO2 lacks a specific DNA-binding homeobox domain but rather assembles into transcriptional regulatory complexes to mediate gene expression by interacting with the widely expressed nuclear LIM interactor (NLI). NLI, known also as CLIM-1, and the related protein CLIM-2 facilitate the formation of heteromeric LIM complexes and also enhance the nuclear retention of LIM proteins. LMO2 and the related protein LMO4 are expressed in thymic precursor cells. LMO4 is also expressed in mature T cells, cranial neural crest cells, somite, dorsal limb bud mesenchyme, motor neurons, and Schwann cell progenitors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85573
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP3-23662
Species: Hu
Applications: Flow, ICC/IF,  IHC-P
AF2726
Species: Hu
Applications: Flow, ICC, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47476
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-75090
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
314-BP
Species: Hu
Applications: BA, BA
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NBP1-87109
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-80943
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-45952
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB414
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
NBP1-84793
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF2185
Species: Hu, Mu, Rt
Applications: IP, WB
AF2459
Species: Hu
Applications: IHC, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for LMO4 Recombinant Protein Antigen (NBP2-49342PEP) (0)

There are no publications for LMO4 Recombinant Protein Antigen (NBP2-49342PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO4 Recombinant Protein Antigen (NBP2-49342PEP) (0)

There are no reviews for LMO4 Recombinant Protein Antigen (NBP2-49342PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LMO4 Recombinant Protein Antigen (NBP2-49342PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMO4 Products

Research Areas for LMO4 Recombinant Protein Antigen (NBP2-49342PEP)

Find related products by research area.

Blogs on LMO4

There are no specific blogs for LMO4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LMO4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO4