Recombinant Human LMCD1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LMCD1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-365 of Human LMCD1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
LMCD1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LMCD1 Protein

  • dyxin
  • LIM and cysteine-rich domains 1
  • LIM and cysteine-rich domains protein 1

Background

The protein encoded by this gene contains a cysteine-rich domain in the N-terminal region and 2 LIM domains in the C-terminal region. It also has several potential phosphorylation and N-myristoylation sites and a single potential N-glycosylation site. The presence of LIM domains implies involvement in protein-protein interactions. Expression of this gene has been detected in most tissues, with highest expression in skeletal muscle. Transcript variants utilizing alternative polyA signals have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77341
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-87987
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00029995-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for LMCD1 Recombinant Protein (H00029995-P01) (0)

There are no publications for LMCD1 Recombinant Protein (H00029995-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMCD1 Recombinant Protein (H00029995-P01) (0)

There are no reviews for LMCD1 Recombinant Protein (H00029995-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMCD1 Recombinant Protein (H00029995-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMCD1 Products

Bioinformatics Tool for LMCD1 Recombinant Protein (H00029995-P01)

Discover related pathways, diseases and genes to LMCD1 Recombinant Protein (H00029995-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMCD1 Recombinant Protein (H00029995-P01)

Discover more about diseases related to LMCD1 Recombinant Protein (H00029995-P01).
 

Pathways for LMCD1 Recombinant Protein (H00029995-P01)

View related products by pathway.

PTMs for LMCD1 Recombinant Protein (H00029995-P01)

Learn more about PTMs related to LMCD1 Recombinant Protein (H00029995-P01).

Blogs on LMCD1

There are no specific blogs for LMCD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LMCD1 Antibody
NBP1-85986
ATF3 Antibody
NBP1-85816

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LMCD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LMCD1