LIS1 Antibody (2C12)

Images

 
Sandwich ELISA: LIS1 Antibody (2C12) [H00005048-M01] - Detection limit for recombinant GST tagged PAFAH1B1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LIS1 Antibody (2C12) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PAFAH1B1 (NP_000421, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSP
Localization
Redistributes to axons during neuronal development. Also localizes to the microtubules of the manchette in elongating spermatids and to the meiotic spindle in spermatocytes (By similarity). Cytoplasm. Localizes to the plus end of microtubules and to the c
Specificity
PAFAH1B1 - platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAFAH1B1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LIS1 Antibody (2C12)

  • LIS-1
  • LIS1PAF-AH alpha
  • LIS2
  • lissencephaly 1 protein
  • Lissencephaly-1 protein
  • MDCR
  • MDS
  • Miller-Dieker syndrome chromosome region
  • PAF acetylhydrolase 45 kDa subunit
  • PAF-AH 45 kDa subunit
  • PAFAH alpha
  • PAFAH
  • PAFAHA
  • platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
  • platelet-activating factor acetylhydrolase IB subunit alpha
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD)
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa
  • platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)

Background

PAFAH1B1 was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LIS1 Antibody (H00005048-M01) (0)

There are no publications for LIS1 Antibody (H00005048-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIS1 Antibody (H00005048-M01) (0)

There are no reviews for LIS1 Antibody (H00005048-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIS1 Antibody (H00005048-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIS1 Products

Research Areas for LIS1 Antibody (H00005048-M01)

Find related products by research area.

Blogs on LIS1

There are no specific blogs for LIS1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIS1 Antibody (2C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAFAH1B1
Entrez
Uniprot