LIM2 Antibody

Images

 
Western Blot: LIM2 Antibody [NBP1-69325] - This Anti-LIM2 antibody was used in Western Blot of COLO205 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIM2 Antibody Summary

Immunogen
Synthetic peptides corresponding to LIM2(lens intrinsic membrane protein 2, 19kDa) The peptide sequence was selected from the N terminal of LIM2. Peptide sequence GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LIM2 and was validated on Western blot.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LIM2 Antibody

  • lens fiber membrane intrinsic protein
  • lens intrinsic membrane protein 2, 19kDa
  • MP17
  • MP18
  • MP19lens intrinsic membrane protein 2 (19kD)
  • MP20

Background

This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization. It acts as a receptor for calmodulin, and may play an important role in both lens development and cataracto

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58661
Species: Hu
Applications: IHC-P
NBP2-58660
Species: Hu
Applications: IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-01926
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-37995
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7288
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5695
Species: Hu, Mu
Applications: WB
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-84380
Species: Hu
Applications: IHC, IHC-P
NBL1-15012
Species: Hu
H00001415-M02
Species: Hu
Applications: WB, ELISA

Publications for LIM2 Antibody (NBP1-69325) (0)

There are no publications for LIM2 Antibody (NBP1-69325).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIM2 Antibody (NBP1-69325) (0)

There are no reviews for LIM2 Antibody (NBP1-69325). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIM2 Antibody (NBP1-69325) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIM2 Products

Bioinformatics Tool for LIM2 Antibody (NBP1-69325)

Discover related pathways, diseases and genes to LIM2 Antibody (NBP1-69325). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIM2 Antibody (NBP1-69325)

Discover more about diseases related to LIM2 Antibody (NBP1-69325).
 

Pathways for LIM2 Antibody (NBP1-69325)

View related products by pathway.

PTMs for LIM2 Antibody (NBP1-69325)

Learn more about PTMs related to LIM2 Antibody (NBP1-69325).

Blogs on LIM2

There are no specific blogs for LIM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIM2
Uniprot