Connexin 50/GJA8 Antibody

Immunocytochemistry/Immunofluorescence: Connexin 50/GJA8 Antibody [NBP2-68799] - Immunohistochemical staining of human eye shows moderate positivity in lens.

Immunohistochemistry-Paraffin: Connexin 50/GJA8 Antibody [NBP2-68799] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Connexin 50/GJA8 Antibody [NBP2-68799] - Staining of human cerebral cortex, eye, kidney and testis using Anti-GJA8 antibody NBP2-68799 (A) shows similar protein distribution across tissues to independent antibody NBP2-68589 (B).

Immunohistochemistry-Paraffin: Connexin 50/GJA8 Antibody [NBP2-68799] - Staining of human testis.

Immunohistochemistry-Paraffin: Connexin 50/GJA8 Antibody [NBP2-68799] - Staining of human kidney.

Immunohistochemistry-Paraffin: Connexin 50/GJA8 Antibody [NBP2-68799] - Staining of human eye.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Connexin 50/GJA8 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKKFRLEGTLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJA8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  Connexin 50/GJA8 Recombinant Protein Antigen (NBP2-68799PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Connexin 50/GJA8 Antibody

• alpha 8, 50kD (connexin 50)
• CAE
• CAE1
• Connexin 50
• Connexin-50
• CX50
• CZP1
• gap junction alpha-8 protein
• gap junction membrane channel protein alpha-8
• gap junction protein, alpha 8, 50kDa (connexin 50)
• gap junction protein, alpha 8, 50kDa
• GJA8
• lens intrinsic membrane protein MP70
• MP70

Background

The 433 amino acid long, 48 kDA transmembrane connexin, gap junction alpha-8 protein encoded by the GJA8 gene is critical in growth and development of lens fiber cells. Mutations in the GJA8 gene may lead to zonular pulverulent cataracts, nuclear progressive cataracts, and cataract-microcornea syndrome. The GJA8 gene has been linked to myopia, microphthalmia, neuronitis, cycstic fibrosis, neuopathy, cervical adenocarcinoma, and juvenile myoclonic epilepsy. The GJA8 gene interacts with TJP1, MIP, MED14, GJA1, and GJB1 to participate in pathways such as gap junction assembly, membrane trafficking, and connexin synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GJA8