LIM Kinase 1 Antibody (1A8)

Images

 
Western Blot: LIM Kinase 1 Antibody (1A8) [H00003984-M01A] - LIMK1 monoclonal antibody (M01A), clone 1A8. Analysis of LIMK1 expression in SW-13.
Western Blot: LIM Kinase 1 Antibody (1A8) [H00003984-M01A] - LIMK1 monoclonal antibody (M01A), clone 1A8 Analysis of LIMK1 expression in HepG2.
Western Blot: LIM Kinase 1 Antibody (1A8) [H00003984-M01A] - LIMK1 monoclonal antibody (M01A), clone 1A8. Analysis of LIMK1 expression in NIH/3T3.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LIM Kinase 1 Antibody (1A8) Summary

Immunogen
LIMK1 (NP_002305 548 a.a. - 647 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Specificity
LIMK1 - LIM domain kinase 1 (1A8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LIMK1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IF usage reported in scientific literature (PMID: 22051374).
Positive Control
LIM Kinase 1 Lysate (NBP2-66135)
Reviewed Applications
Read 1 Review rated 5
using
H00003984-M01A in the following applications:

Publications
Read Publications using
H00003984-M01A in the following applications:

  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LIM Kinase 1 Antibody (1A8)

  • EC 2.7.11.1
  • LIM domain kinase 1
  • LIM motif-containing protein kinase
  • LIMKLIMK-1

Background

There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85783
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP2-52568
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00003984-M01A
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for LIM Kinase 1 Antibody (H00003984-M01A)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for LIM Kinase 1 Antibody (H00003984-M01A) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00003984-M01A:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot LIM Kinase 1 H00003984-M01A
Enlarge
reviewed by:
Maria Rubio
WB Human 05/26/2011
View

Summary

ApplicationWestern Blot
Sample TestedHuman brain homogenate
SpeciesHuman
Lot09133
CommentsI obtained a single band at 70kD. I blocked in li-cor buffer (Odyssey) for 1h at room temperature followed by overnight incubation of LIMK 1:500 in li-cor + 0.1%tween. Secondary infrared antibody was used at a 1:5000 concentration for 1h at room temperature.

Blocking

Blocking DetailsBlocking Time: 1 hour, Blocking Temp: 23 degrees Celsius

Primary Anitbody

Dilution RatioIncubation Dilution Buffer: li-cor + 0.1% tween, Incubation Time: overnight, Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab Dilution Ratio: 1:5000

Details

Detection NotesSpecific Bands: 70 kDa, Non-Specific Bands: None

Comments

CommentsI obtained a single band at 70kD. I blocked in li-cor buffer (Odyssey) for 1h at room temperature followed by overnight incubation of LIMK 1:500 in li-cor + 0.1%tween. Secondary infrared antibody was used at a 1:5000 concentration for 1h at room temperature.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIM Kinase 1 Antibody (H00003984-M01A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for LIM Kinase 1 Antibody (H00003984-M01A)

Discover related pathways, diseases and genes to LIM Kinase 1 Antibody (H00003984-M01A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIM Kinase 1 Antibody (H00003984-M01A)

Discover more about diseases related to LIM Kinase 1 Antibody (H00003984-M01A).
 

Pathways for LIM Kinase 1 Antibody (H00003984-M01A)

View related products by pathway.

PTMs for LIM Kinase 1 Antibody (H00003984-M01A)

Learn more about PTMs related to LIM Kinase 1 Antibody (H00003984-M01A).
 

Research Areas for LIM Kinase 1 Antibody (H00003984-M01A)

Find related products by research area.

Blogs on LIM Kinase 1

There are no specific blogs for LIM Kinase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Maria Rubio
05/26/2011
Application: WB
Species: Human

Bioinformatics

Gene Symbol LIMK1
Entrez
Uniprot