LHX9 Antibody (1D8) - Azide and BSA Free

Western Blot: LHX9 Antibody (1D8) [H00056956-M08] - Analysis of LHX9 expression in transfected 293T cell line by LHX9 monoclonal antibody (M08), clone 1D8. Lane 1: LHX9 transfected lysate (Predicted MW: 44 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LHX9 Antibody (1D8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LHX9 Antibody (1D8) - Azide and BSA Free (H00056956-M08) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LHX9 (NP_001014434.1, 291 a.a. ~ 388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
• Specificity: This product is specific for Human LHX9 monoclonal antibody (M08), clone 1D8 [Gene ID: 56956].
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LHX9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant LHX9.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LHX9 Antibody (1D8) - Azide and BSA Free

• LIM homeobox 9
• LIM homeobox protein 9
• LIM/homeobox protein Lhx9

Background

The LHX9 gene encodes a protien of the LIM homeobox gene family of transcription factors. The encoded protien contains a homeodomain an two zinc binding LIM domains which are used in interactions between protiens. This protien is similar to a inactivated protien in a mouse that causes gonadal agenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LHX9
• Uniprot:
  • NP_001014434(Human)