LHX6 Antibody (3E8) - Azide and BSA Free

Western Blot: LHX6 Antibody (3E8) [H00026468-M05] - Analysis of LHX6 expression in HepG2 (Cat # L019V1).

Western Blot: LHX6 Antibody (3E8) [H00026468-M05] - Analysis of LHX6 expression in NIH/3T3 (Cat # L018V1).

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 3E8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LHX6 Antibody (3E8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LHX6 Antibody (3E8) - Azide and BSA Free (H00026468-M05) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
• Specificity: LHX6 (3E8)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LHX6
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LHX6 Antibody (3E8) - Azide and BSA Free

• LHX6.1LIM homeobox protein 6
• LIM homeobox 6
• LIM homeodomain protein 6.1
• LIM/homeobox protein Lhx6
• LIM/homeobox protein Lhx6.1
• MGC119542
• MGC119544
• MGC119545

Background

This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LHX6
• Entrez:
  • 26468(Human)
• OMIM:
  • 608215(Human)
• Uniprot:
  • NP_055183(Human)