Recombinant Human Lhx4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Lhx4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 208 - 306 of Human LHX4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGS

Protein/Peptide Type
Partial Recombinant Protein
Gene
LHX4

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Lhx4 Protein

  • CPHD4
  • FLJ22769
  • Gsh4
  • LIM homeobox 4
  • LIM homeobox protein 4
  • LIM/homeobox protein Lhx4

Background

LHX4 - LIM homeobox 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008022-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP1-44054
Species: Hu
Applications: PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2569
Species: Hu
Applications: WB, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-61438
Species: Hu
Applications: IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Lhx4 Partial Recombinant Protein (H00089884-Q01) (0)

There are no publications for Lhx4 Partial Recombinant Protein (H00089884-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lhx4 Partial Recombinant Protein (H00089884-Q01) (0)

There are no reviews for Lhx4 Partial Recombinant Protein (H00089884-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lhx4 Partial Recombinant Protein (H00089884-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lhx4 Products

Bioinformatics Tool for Lhx4 Partial Recombinant Protein (H00089884-Q01)

Discover related pathways, diseases and genes to Lhx4 Partial Recombinant Protein (H00089884-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lhx4 Partial Recombinant Protein (H00089884-Q01)

Discover more about diseases related to Lhx4 Partial Recombinant Protein (H00089884-Q01).
 

Pathways for Lhx4 Partial Recombinant Protein (H00089884-Q01)

View related products by pathway.

PTMs for Lhx4 Partial Recombinant Protein (H00089884-Q01)

Learn more about PTMs related to Lhx4 Partial Recombinant Protein (H00089884-Q01).

Blogs on Lhx4

There are no specific blogs for Lhx4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Lhx4 Antibody (1D6)
H00089884-M15

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Lhx4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LHX4