LHX3 Antibody (2C10) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: LHX3 Antibody (2C10) [H00008022-M08] - Analysis of monoclonal antibody to LHX3 on HeLa cell. Antibody concentration 10 ug/ml

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2C10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LHX3 Antibody (2C10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: LHX3 (NP_055379, 228 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRP
• Specificity: LHX3 - LIM homeobox 3
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LHX3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LHX3 Antibody (2C10) - Azide and BSA Free

• CPHD3
• DKFZp762A2013
• LIM homeobox 3
• LIM homeobox protein 3
• LIM/homeobox protein Lhx3
• LIM/homeodomain protein LHX3
• LIM3
• M2-LHX3

Background

This gene encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LHX3
• Entrez:
  • 8022(Human)
• OMIM:
  • 262600(Human)
• Uniprot:
  • NP_055379(Human)