LHX3 Antibody (2C10)

Images

 
Immunocytochemistry/ Immunofluorescence: LHX3 Antibody (2C10) [H00008022-M08] - Analysis of monoclonal antibody to LHX3 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LHX3 Antibody (2C10) Summary

Immunogen
LHX3 (NP_055379, 228 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRP
Specificity
LHX3 - LIM homeobox 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LHX3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LHX3 Antibody (2C10)

  • CPHD3
  • DKFZp762A2013
  • LIM homeobox 3
  • LIM homeobox protein 3
  • LIM/homeobox protein Lhx3
  • LIM/homeodomain protein LHX3
  • LIM3
  • M2-LHX3

Background

This gene encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92273
Species: Hu, Mu
Applications: IHC, IHC-P
H00089884-M15
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-68688
Species: Hu
Applications: IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-32252
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
H00005308-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
NBP2-01926
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-52823
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-88644
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45298
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NB600-480
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P

Publications for LHX3 Antibody (H00008022-M08) (0)

There are no publications for LHX3 Antibody (H00008022-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHX3 Antibody (H00008022-M08) (0)

There are no reviews for LHX3 Antibody (H00008022-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LHX3 Antibody (H00008022-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LHX3 Products

Bioinformatics Tool for LHX3 Antibody (H00008022-M08)

Discover related pathways, diseases and genes to LHX3 Antibody (H00008022-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHX3 Antibody (H00008022-M08)

Discover more about diseases related to LHX3 Antibody (H00008022-M08).
 

Pathways for LHX3 Antibody (H00008022-M08)

View related products by pathway.

PTMs for LHX3 Antibody (H00008022-M08)

Learn more about PTMs related to LHX3 Antibody (H00008022-M08).

Blogs on LHX3.

A good helper on validating your FLOW and IHC data - Rabbit IgG Isotype Control
Isotype controls are primarily used as negative controls in flow cytometry but they can also be used for immunohistochemistry. They are used to approximate the non-specific target primary antibody binding due to protein-protein interactions, binding t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LHX3 Antibody (2C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol LHX3
Entrez
OMIM
Uniprot