Home » LHX2 » LHX2 Research Products » LHX2 Antibody (1E6)

LHX2 Antibody (1E6)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: LHX2 Antibody (1E6) [H00009355-M02] - Analysis of LHX2 expression in transfected 293T cell line by LHX2 monoclonal antibody (M02), clone 1E6.Lane 1: LHX2 transfected lysate(44.4 KDa).Lane 2: Non-transfected lysate.
Western Blot: LHX2 Antibody (1E6) [H00009355-M02] - Analysis of LHX2 expression in transfected 293T cell line by LHX2 monoclonal antibody (M02), clone 1E6.Lane 1: LHX2 transfected lysate(44.4 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: LHX2 Antibody (1E6) [H00009355-M02] - Analysis of monoclonal antibody to LHX2 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

LHX2 Antibody (1E6) Summary

Immunogen
LHX2 (NP_004780, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMR
Specificity
LHX2 - LIM homeobox 2 (1E6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LHX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LHX2 Antibody (1E6)

  • hLhx2
  • Homeobox protein LH-2
  • LH-2
  • LH2MGC138390
  • LIM homeobox 2
  • LIM homeobox protein 2
  • LIM HOX gene 2
  • LIM/homeobox protein Lhx2

Background

This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
(2 Publications)
Species: Hu, Mu
Applications: WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(16 Publications)
Species: Hu
Regucalcin Antibody
NBP1-80849
Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PDLIM5 Antibody
NBP1-84843
Western Blot: PDLIM5 Antibody [NBP1-84843] - Analysis using Anti-PDLIM5 antibody NBP1-84843 (A) shows similar pattern to independent antibody NBP1-84842 (B).
Immunocytochemistry/Immunofluorescence: PDLIM5 Antibody [NBP1-84843] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & focal adhesion sites.
Immunohistochemistry-Paraffin: PDLIM5 Antibody [NBP1-84843] - Staining of human testis shows no positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Lysine Hydroxylase
2/PLOD2 Antibody
H00005352-B01P
Western Blot: Lysine Hydroxylase 2/PLOD2 Antibody [H00005352-B01P] - Analysis of PLOD2 expression in human kidney.
Immunocytochemistry/Immunofluorescence: Lysine Hydroxylase 2/PLOD2 Antibody [H00005352-B01P] - Analysis of purified antibody to PLOD2 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Lysine Hydroxylase 2/PLOD2 Antibody [H00005352-B01P] - Analysis of PLOD2 expression in transfected 293T cell line by PLOD2 polyclonal antibody. Lane 1: PLOD2 transfected lysate(83.38 KDa). Lane 2: Non-transfected lysate.
(1 Review)
(3 Publications)
Species: Hu
Applications: WB, ICC/IF
PLOD3 Antibody
NBP1-81307
Western Blot: PLOD3 Antibody [NBP1-81307] - Analysis in human cell lines SK-MEL-30 and HEK293 using Anti-PLOD3 antibody. Corresponding PLOD3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human appendix shows weak to moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
Pax6 Antibody
NB300-750
Western Blot: Pax6 Antibody [NB300-750] - Analysis of sheep retinal extract
Immunocytochemistry/Immunofluorescence: Pax6 Antibody [NB300-750] - ARPE-19 monolayer on glass substrate. Fixative Methanol Blocking Goat Serum. Dilution 1:100. Incubation 1h @ RT. This image was submitted via customer Review.
Western Blot: Pax6 Antibody [NB300-750] - Analysis of rat whole eye extract
(4 Reviews)
(4 Publications)
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
RB1 Antibody
NB100-56888
Western Blot: RB1 Antibody [NB100-56888] - Analysis of Retinoblastoma 1 in 30 ugs of Jurkat cell lysate using NB100-56888 at 1:1000 dilution.
(2 Reviews)
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
LHX9 Antibody
NBP1-86114
Western Blot: LHX9 Antibody [NBP1-86114] - Analysis in control (vector only transfected HEK293T lysate) and LHX9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: LHX9 Antibody [NBP1-86114] - Immunofluorescent staining of human cell line BJ shows localization to nucleus.
Immunohistochemistry-Paraffin: LHX9 Antibody [NBP1-86114] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog # 1845-SH) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
(5 Reviews)
(36 Publications)
Species: Hu
LDB1 Antibody
NBP1-31362
Western Blot: LDB1 Antibody [NBP1-31362] - Wild-type (WT) and LDB1 knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with LDB1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: LDB1 Antibody [NBP1-31362] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: LDB1 protein stained by LDB1 antibody [N2C3] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-31362] - mouse muscle.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Afamin Antibody
NBP2-15304
Western Blot: Afamin Antibody [NBP2-15304] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa D: HepG2 7. 5% SDS PAGE; antibody diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: Afamin Antibody [NBP2-15304] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Afamin Antibody [NBP2-15304] - Paraffin-embedded human colon. AFM antibody diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
RAX Antibody
NB100-56467
Western Blot: RAX Antibody [NB100-56467] - analysis of Rax in the 1) absence and 2) presence of immunizing peptide in Jurkat cell lysate using this antibody. 5 ug/ml.
Species: Hu, Ca, Pm
Applications: WB
LDB2 Antibody
NB600-480
Western Blot: LDB2 Antibody [NB600-480] - Analysis of a 43-kDa band corresponding to LDB2 in a lysates prepared from human kidney (lane 1) and mouse spleen (lane 2) tissues. Approximately 18 ug of lysate was run on a SDS-PAGE and transferred onto nitrocellulose followed by reaction with a 1:500 dilution of anti-LDB2 antibody. Detection occurred using a 1:5,000 dilution of HRP-labeled Goat anti-Rabbit IgG for 1 hour at room temperature. A chemiluminescence system was used for signal detection (Roche) using a 1 min exposure time.
Immunohistochemistry: LDB2 Antibody [NB600-480] - Used at a 5 ug/ml to detect LDB2 in human brain cortex tissue. The image shows the localization of antibody as the precipitated red signal, with a hematoxylin purple nuclear counter stain. Tissue was formalin-fixed and paraffin embedded.
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
CHX10 Antibody
NBP1-84476
Western Blot: CHX10 Antibody [NBP1-84476] - Analysis in control (vector only transfected HEK293T lysate) and vSX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CHX10 Antibody [NBP1-84476] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
Immunohistochemistry-Paraffin: CHX10 Antibody [NBP1-84476] - Staining of human retina shows strong nuclear positivity in inner nuclear layer.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
LIM1 Antibody
(OTI2D5)
NBP2-01926
Western Blot: LIM1 Antibody (OTI2D5) [NBP2-01926] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY LIM1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-LIM1.
Immunocytochemistry/Immunofluorescence: LIM1 Antibody (OTI2D5) [NBP2-01926] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY LIM1.
Immunohistochemistry-Paraffin: LIM1 Antibody (OTI2D5) [NBP2-01926] - Staining of paraffin-embedded Human prostate tissue using anti-LIM1 mouse monoclonal antibody.
(3 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SIX6 Antibody
NBP1-82478
Western Blot: SIX6 Antibody [NBP1-82478] - Analysis in control (vector only transfected HEK293T lysate) and SIX6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: SIX6 Antibody [NBP1-82478] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SIX6 Antibody [NBP1-82478] - Staining of human retina, inner nuclear layer, shows moderate nuclear positivity.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Otx2 Antibody
[Unconjugated]
AF1979
Otx2 was detected in immersion fixed NTera‑2 human testicular embryonic carcinoma cell line using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Otx2 was detected in immersion fixed paraffin-embedded sections of mouse embryo (14 d.p.c.) using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to developing nervous system. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Simple Western lane view shows lysates of IMR‑32 human neuroblastoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Otx2 at approximately 48 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(6 Reviews)
(37 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, ICC
ASCL1/Mash1
Antibody [Unconjugate
AF2567
ASCL1/Mash1 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Mu
Applications: WB, IHC
LHX2 Antibody (1E6)
H00009355-M02
LHX2 Antibody (1E6)
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for LHX2 Antibody (H00009355-M02) (0)

There are no publications for LHX2 Antibody (H00009355-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHX2 Antibody (H00009355-M02) (0)

There are no reviews for LHX2 Antibody (H00009355-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LHX2 Antibody (H00009355-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional LHX2 Products

Bioinformatics Tool for LHX2 Antibody (H00009355-M02)

Discover related pathways, diseases and genes to LHX2 Antibody (H00009355-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHX2 Antibody (H00009355-M02)

Discover more about diseases related to LHX2 Antibody (H00009355-M02).
 

Pathways for LHX2 Antibody (H00009355-M02)

View related products by pathway.

PTMs for LHX2 Antibody (H00009355-M02)

Learn more about PTMs related to LHX2 Antibody (H00009355-M02).

Blogs on LHX2

There are no specific blogs for LHX2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LHX2 Antibody (1E6) and receive a gift card or discount.


Bioinformatics

Gene Symbol LHX2
Entrez
Uniprot