LHX2 Antibody (1E6) Summary
Immunogen |
LHX2 (NP_004780, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMR |
Specificity |
LHX2 - LIM homeobox 2 (1E6) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
LHX2 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Immunocytochemistry/Immunofluorescence
|
Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for LHX2 Antibody (1E6)
Background
This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for LHX2 Antibody (H00009355-M02) (0)
There are no publications for LHX2 Antibody (H00009355-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LHX2 Antibody (H00009355-M02) (0)
There are no reviews for LHX2 Antibody (H00009355-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LHX2 Antibody (H00009355-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional LHX2 Products
Bioinformatics Tool for LHX2 Antibody (H00009355-M02)
Discover related pathways, diseases and genes to LHX2 Antibody (H00009355-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for LHX2 Antibody (H00009355-M02)
Discover more about diseases related to LHX2 Antibody (H00009355-M02).
| | Pathways for LHX2 Antibody (H00009355-M02)
View related products by pathway.
|
PTMs for LHX2 Antibody (H00009355-M02)
Learn more about PTMs related to LHX2 Antibody (H00009355-M02).
|
Blogs on LHX2