LHX2 Antibody (1E6)


Western Blot: LHX2 Antibody (1E6) [H00009355-M02] - Analysis of LHX2 expression in transfected 293T cell line by LHX2 monoclonal antibody (M02), clone 1E6.Lane 1: LHX2 transfected lysate(44.4 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: LHX2 Antibody (1E6) [H00009355-M02] - Analysis of monoclonal antibody to LHX2 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

LHX2 Antibody (1E6) Summary

LHX2 (NP_004780, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMR
LHX2 - LIM homeobox 2 (1E6)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LHX2 Antibody (1E6)

  • hLhx2
  • Homeobox protein LH-2
  • LH-2
  • LH2MGC138390
  • LIM homeobox 2
  • LIM homeobox protein 2
  • LIM HOX gene 2
  • LIM/homeobox protein Lhx2


This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for LHX2 Antibody (H00009355-M02) (0)

There are no publications for LHX2 Antibody (H00009355-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHX2 Antibody (H00009355-M02) (0)

There are no reviews for LHX2 Antibody (H00009355-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LHX2 Antibody (H00009355-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LHX2 Products

Bioinformatics Tool for LHX2 Antibody (H00009355-M02)

Discover related pathways, diseases and genes to LHX2 Antibody (H00009355-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHX2 Antibody (H00009355-M02)

Discover more about diseases related to LHX2 Antibody (H00009355-M02).

Pathways for LHX2 Antibody (H00009355-M02)

View related products by pathway.

PTMs for LHX2 Antibody (H00009355-M02)

Learn more about PTMs related to LHX2 Antibody (H00009355-M02).

Blogs on LHX2

There are no specific blogs for LHX2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LHX2 Antibody (1E6) and receive a gift card or discount.


Gene Symbol LHX2