Leukotriene B4 Receptor 2 Antibody - BSA Free

Western Blot: Leukotriene B4 Receptor 2 Antibody [NBP3-09429] - Western blot analysis of Leukotriene B4 Receptor 2 in Placenta lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Leukotriene B4 Receptor 2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Leukotriene B4 Receptor 2. Peptide sequence TRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGP
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LTB4R2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Leukotriene B4 Receptor 2 Antibody - BSA Free

• BLT2
• BLT2LTB4 receptor JULF2
• BLT2R
• BLTR2
• BLTR2LTB4-R2
• JULF2
• KPG_004
• Leukotriene B4 R2
• leukotriene B4 receptor 2
• Leukotriene B4 receptor BLT2
• Leukotriene B4R2
• LTB4-R 2
• LTB4R2
• NOP9
• Seven transmembrane receptor BLTR2

Background

LUSTR2 is an Orphan-U GPCR with an unknown ligand. ESTs have been isolated from human tissue libraries, especially normal kidney, ovary and pituitary, and cancerous bladder, duodenum, genitourinary tract and placenta.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LTB4R2