Leukotriene B4 R1 Antibody

Images

 
Western Blot: Leukotriene B4 R1 Antibody [NBP1-89959] - Analysis in control (vector only transfected HEK293T lysate) and LTB4R over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Leukotriene B4 R1 Antibody [NBP1-89959] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Leukotriene B4 R1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE
Specificity
Specificity of human Leukotriene B4 R1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LTB4R
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-89959.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23631827)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Leukotriene B4 R1 Antibody

  • BLT1
  • chemokine receptor-like 1
  • CMKRL1
  • Leukotriene B4 R1
  • leukotriene B4 receptor
  • Leukotriene B4R1
  • LTB4R
  • LTB4R1
  • LTBR1
  • P2Y purinoceptor 7
  • purinergic receptor P2Y, G-protein coupled, 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS4985
Species: Hu, Mu, Rt, Bv, Ha
Applications: IHC-P
NBP2-14207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NLS418
Species: Hu
Applications: IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NLS1017
Species: Hu, Mu, Bt, Bv, Ca, Eq
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
NLS2576
Species: Hu, Rt, Mk
Applications: IHC, IHC-P

Publications for Leukotriene B4 R1 Antibody (NBP1-89959)(1)

Reviews for Leukotriene B4 R1 Antibody (NBP1-89959) (0)

There are no reviews for Leukotriene B4 R1 Antibody (NBP1-89959). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Leukotriene B4 R1 Antibody (NBP1-89959) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Leukotriene B4 R1 Products

Bioinformatics Tool for Leukotriene B4 R1 Antibody (NBP1-89959)

Discover related pathways, diseases and genes to Leukotriene B4 R1 Antibody (NBP1-89959). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Leukotriene B4 R1 Antibody (NBP1-89959)

Discover more about diseases related to Leukotriene B4 R1 Antibody (NBP1-89959).
 

Pathways for Leukotriene B4 R1 Antibody (NBP1-89959)

View related products by pathway.

PTMs for Leukotriene B4 R1 Antibody (NBP1-89959)

Learn more about PTMs related to Leukotriene B4 R1 Antibody (NBP1-89959).
 

Research Areas for Leukotriene B4 R1 Antibody (NBP1-89959)

Find related products by research area.

Blogs on Leukotriene B4 R1

There are no specific blogs for Leukotriene B4 R1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Leukotriene B4 R1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTB4R