LEAP2 Antibody

Product Discontinued

LEAP2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LEAP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LEAP2 Antibody

• LEAP-2liver-expressed antimicrobial peptide 2
• liver expressed antimicrobial peptide 2

Background

LEAP2 is a cysteine-rich cationic antimicrobial peptide (Krause et al., 2003 (PubMed 12493837)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LEAP2