LDOC1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LDOC1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for LDOC1 Antibody - BSA Free
Background
LDOC1, also known as Protein LDOC1, is a 146 amino acid protein that is 17 kDa, nucleus located, down-regulated in some cancer cell lines, thought to act as a regulator of the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB), and may participate in the development and/or progression of some cancers. This protein is currently being studied for research on the following diseases and disorders: breast cancer, cryptorchidism, chronic lymphocytic leukemia, lymphocytic leukemia, pancreatic cancer, thyroiditis, pancreatitis, and leukemia. Interactions with LDOC1 protein have been shown to involve over 40 proteins including FXR2, ABLIM1, NRIP1, FOSL1, and CCDC858 proteins in negative regulation of cell proliferation pathwyas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Publications for LDOC1 Antibody (NBP2-57418) (0)
There are no publications for LDOC1 Antibody (NBP2-57418).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LDOC1 Antibody (NBP2-57418) (0)
There are no reviews for LDOC1 Antibody (NBP2-57418).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LDOC1 Antibody (NBP2-57418) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LDOC1 Products
Research Areas for LDOC1 Antibody (NBP2-57418)
Find related products by research area.
|
Blogs on LDOC1