LDOC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LDOC1 Antibody [NBP2-57418] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LDOC1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LDOC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LDOC1 Recombinant Protein Antigen (NBP2-57418PEP)

Reactivity Notes

Rat 81%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LDOC1 Antibody - BSA Free

• BCUR1
• breast cancer, up-regulated 1
• Leucine zipper protein down-regulated in cancer cells
• leucine zipper, down-regulated in cancer 1
• Mar7
• Mart7
• protein LDOC1

Background

LDOC1, also known as Protein LDOC1, is a 146 amino acid protein that is 17 kDa, nucleus located, down-regulated in some cancer cell lines, thought to act as a regulator of the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB), and may participate in the development and/or progression of some cancers. This protein is currently being studied for research on the following diseases and disorders: breast cancer, cryptorchidism, chronic lymphocytic leukemia, lymphocytic leukemia, pancreatic cancer, thyroiditis, pancreatitis, and leukemia. Interactions with LDOC1 protein have been shown to involve over 40 proteins including FXR2, ABLIM1, NRIP1, FOSL1, and CCDC858 proteins in negative regulation of cell proliferation pathwyas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LDOC1