Recombinant Human LCoR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LCoR Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-406 of Human LCOR full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQSRKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMSG

Protein/Peptide Type
Recombinant Protein
Gene
LCOR

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LCoR Protein

  • FLJ38026
  • KIAA1795RP11-175O19.1
  • LCoR
  • ligand dependent nuclear receptor corepressor
  • Mblk1-related protein 2
  • MLR2
  • MLR2ligand-dependent corepressor

Background

LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box (Fernandes et al., 2003 [PubMed 12535528]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82037
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IP
AF3499
Species: Hu
Applications: WB
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for LCoR Recombinant Protein (H00084458-P01) (0)

There are no publications for LCoR Recombinant Protein (H00084458-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCoR Recombinant Protein (H00084458-P01) (0)

There are no reviews for LCoR Recombinant Protein (H00084458-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCoR Recombinant Protein (H00084458-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LCoR Products

Bioinformatics Tool for LCoR Recombinant Protein (H00084458-P01)

Discover related pathways, diseases and genes to LCoR Recombinant Protein (H00084458-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCoR Recombinant Protein (H00084458-P01)

Discover more about diseases related to LCoR Recombinant Protein (H00084458-P01).
 

Pathways for LCoR Recombinant Protein (H00084458-P01)

View related products by pathway.

Blogs on LCoR

There are no specific blogs for LCoR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LCoR Antibody
NBP1-83477

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LCoR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LCOR
Entrez