LAT3 Antibody - BSA Free

Western Blot: LAT3 Antibody [NBP1-59431] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Western Blot: LAT3 Antibody [NBP1-59431] - Human Placenta lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LAT3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC43A1(solute carrier family 43, member 1) The peptide sequence was selected from the middle region of SLC43A1. Peptide sequence AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 3.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC43A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LAT3 Antibody - BSA Free

• LAT3prostate cancer overexpressed gene 1
• PB39L-type amino acid transporter 3
• POV1large neutral amino acids transporter small subunit 3
• Prostate cancer overexpressed gene 1 protein
• R00504
• Solute carrier family 43 member 1
• solute carrier family 43, member 1

Background

SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC43A1
• Uniprot:
  • O75387(Human)