Home » LASS1 » LASS1 Antibodies » LASS1 Antibody (2E8)

LASS1 Antibody (2E8)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: LASS1 Antibody (2E8) [H00010715-M01] - Detection against Immunogen (31.24 KDa) .
Western Blot: LASS1 Antibody (2E8) [H00010715-M01] - Detection against Immunogen (31.24 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

LASS1 Antibody (2E8) Summary

Immunogen
LASS1 (NP_067090.1, 301 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Localization
Endoplasmic reticulum membrane; Multi-pass membrane protein
Specificity
LASS1 - LAG1 longevity assurance homolog 1 (S. cerevisiae)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CERS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LASS1 Antibody (2E8)

  • CerS1
  • LAG1 homolog, ceramide synthase 1
  • LAG1 longevity assurance homolog 1
  • LAG1MGC90349
  • longevity assurance (LAG1, S. cerevisiae) homolog 1
  • Longevity assurance gene 1 protein homolog 1
  • Protein UOG-1
  • UOG1LAG1 longevity assurance homolog 1 (S. cerevisiae)
  • upstream of GDF1

Background

This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LASS6 Antibody
H00253782-A01
Western Blot: LASS6 Antibody [H00253782-A01] - LASS6 polyclonal antibody (A01) Western Blot analysis of LASS6 expression in IMR-32.
Western Blot: LASS6 Antibody [H00253782-A01] - Detection against Immunogen (33.81 KDa) .
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: ELISA, WB
Lass5 Antibody -
BSA Free
NBP1-76964
Western Blot: Lass5 Antibody [NBP1-76964] - Human neuroblastoma cell lines untreated or treated with various drugs. Image from verified customer review.
Immunohistochemistry-Paraffin: Lass5 Antibody [NBP1-76964] - Mouse brain tissue with LASS5 antibody at 2.5 ug/ml.
Western Blot: Lass5 Antibody [NBP1-76964] - SK-N-SH lysate with LASS5 antibody at (A) 1 and (B) 2 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
LASS2 Antibody
(1A6)
H00029956-M01A
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6 Western Blot analysis of LASS2 expression in HepG2.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6. Western Blot analysis of LASS2 expression in NIH/3T3.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, WB
csl/RBPJK Antibody
NBP1-33427
Chromatin Immunoprecipitation (ChIP): csl/RBPJK Antibody [NBP1-33427] - Sheared, cross-linked chromatin was prepared from Jurkat T-ALL cells using the Covaris TruChIP kit and shearing with the LE220 sonicator. The chromatin buffer was adjusted to 150 mM NaCl, 20 mM Tris-Cl pH 8, 2 mM EDTA, and 1% Triton X-100. Three antibodies, as well as pure pre-immune rabbit IgG control, were added to each IP reaction, consisting of 7 million cells, and incubated overnight with mixing at 4 C. The antibodies were captured with Magna ChIP Protein A+G beads (Millipore), washed with three wash buffers, and the DNA eluted and purified with the iPure v2 kit (Diagenode). The purified DNA was normalized to the input control with qPCR quantification of the insulin exon 1 gene (INS) and an RBPJ binding site in the promoter of HES1. Image from verified customer review.
Western Blot: csl/RBPJK Antibody [NBP1-33427] - Sample (30 ug of whole cell lysate) A: Jurkat 7.5% SDS PAGE diluted at 1:2000
Immunocytochemistry/Immunofluorescence: csl/RBPJK Antibody [NBP1-33427] - Analysis of paraformaldehyde-fixed HeLa at 1:100 dilution.
(1 Review)
Species: Hu
Applications: ChIP, ICC/IF, WB
LASS4 Antibody
(7D5)
H00079603-M03
ELISA: LASS4 Antibody (7D5) [H00079603-M03] - Detection limit for recombinant GST tagged LASS4 is approximately 0.3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of monoclonal antibody to LASS4 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of LASS4 expression in transfected 293T cell line by LASS4 monoclonal antibody (M03), clone 7D5. Lane 1: LASS4 transfected lysatE (46.4 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ELISA, ICC/IF, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, IP, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
HDAC1 Antibody
NB100-56340
Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Simple Western: HDAC1 Antibody [NB100-56340] - Simple Western lane view shows a specific band for HDAC1 in 0.5 mg/ml of HEK293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: HDAC1 Antibody [NB100-56340] - Analysis of HDAC1 in HEK293 cell lysate with this antibody.
(2 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
CLN8 Antibody
NBP1-91333
Western Blot: CLN8 Antibody [NBP1-91333] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Species: Hu
Applications: WB
Recombinant Human
TRAM1 GST (N-Term) Pr ...
H00023471-P01
SDS-Page: Recombinant Human TRAM1 Protein [H00023471-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Sphingosine Kinase
1/SPHK1 Antibody (1D6 ...
H00008877-M01
ELISA: Sphingosine Kinase 1/SPHK1 Antibody (1D6) [H00008877-M01] - Detection limit for recombinant GST tagged SPHK1 is approximately 1ng/ml as a capture antibody.
Western Blot: Sphingosine Kinase 1/SPHK1 Antibody (1D6) [H00008877-M01] - SPHK1 monoclonal antibody (M01), clone 1D6 Western Blot analysis of SPHK1 expression in A-431 ( Cat # L015V1 ).
Western Blot: Sphingosine Kinase 1/SPHK1 Antibody (1D6) [H00008877-M01] - Analysis of SPHK1 expression in transfected 293T cell line by SPHK1 monoclonal antibody (M01), clone 1D6.Lane 1: SPHK1 transfected lysate(43.9 KDa).Lane 2: Non-transfected lysate.
(12 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
GDF-1 Antibody
(748450)
MAB6937
Western blot shows lysates of human brain (cortex) tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human GDF‑1 Monoclonal Antibody (Catalog # MAB6937) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for GDF‑1 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin: Notch-1 Antibody (mN1A) [NB100-78486] - Analysis of FFPE human pancreatic cancer using 1:10 dilution of Notch-1 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) was performed using Aperio AT2 (Leica Biosystems). Cytoplasmic staining in epithelial cells was observed. Staining was performed by Histowiz.
Knockout Validated: Notch-1 Antibody (mN1A) [NB100-78486] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Notch-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/mL of Mouse Anti-Human Notch-1 Monoclonal Antibody (Catalog # NB100-78486) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for Notch-1 at approximately 110 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Flow Cytometry: Notch-1 Antibody (mN1A) [NB100-78486] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and MCF-7 (B) cells using Notch1 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(8 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
ASC1 Antibody
NBP1-89656
Western Blot: ASC1 Antibody [NBP1-89656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ASC1 Antibody [NBP1-89656] - Staining of human colon shows cytoplasmic positivity in glandular cells.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
LASS3 Antibody
NBP1-84536
Immunocytochemistry/Immunofluorescence: LASS3 Antibody [NBP1-84536] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LASS3 Antibody [NBP1-84536] - Staining of human skin shows weak to moderate nuclear positivity in keratinocytes.
Immunohistochemistry-Paraffin: LASS3 Antibody [NBP1-84536] - Staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TRAM/TICAM2
Antibody
NBP2-24686
Immunohistochemistry-Paraffin: TRAM/TICAM2 Antibody [NBP2-24686] - Analysis of TAG/TIRAP3b in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.
Western Blot: TRAM/TICAM2 Antibody [NBP2-24686] - Analysis of TICAM2 in K562 cell lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24686 at 3 ug/ml.
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
SLC7A10 Antibody
NBP3-12253
SLC7A10 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
LASS1 Antibody
(2E8)
H00010715-M01
LASS1 Antibody (2E8)
Species: Hu
Applications: WB, ELISA

Publications for LASS1 Antibody (H00010715-M01) (0)

There are no publications for LASS1 Antibody (H00010715-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LASS1 Antibody (H00010715-M01) (0)

There are no reviews for LASS1 Antibody (H00010715-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LASS1 Antibody (H00010715-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LASS1 Products

Bioinformatics Tool for LASS1 Antibody (H00010715-M01)

Discover related pathways, diseases and genes to LASS1 Antibody (H00010715-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LASS1 Antibody (H00010715-M01)

Discover more about diseases related to LASS1 Antibody (H00010715-M01).
 

Pathways for LASS1 Antibody (H00010715-M01)

View related products by pathway.

PTMs for LASS1 Antibody (H00010715-M01)

Learn more about PTMs related to LASS1 Antibody (H00010715-M01).

Blogs on LASS1

There are no specific blogs for LASS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LASS1 Antibody (2E8) and receive a gift card or discount.


Bioinformatics

Gene Symbol CERS1
Entrez
OMIM
Uniprot