LASS1 Antibody (2E8)

Images

 
Western Blot: LASS1 Antibody (2E8) [H00010715-M01] - Detection against Immunogen (31.24 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LASS1 Antibody (2E8) Summary

Immunogen
LASS1 (NP_067090.1, 301 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Localization
Endoplasmic reticulum membrane; Multi-pass membrane protein
Specificity
LASS1 - LAG1 longevity assurance homolog 1 (S. cerevisiae)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CERS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LASS1 Antibody (2E8)

  • CerS1
  • LAG1 homolog, ceramide synthase 1
  • LAG1 longevity assurance homolog 1
  • LAG1MGC90349
  • longevity assurance (LAG1, S. cerevisiae) homolog 1
  • Longevity assurance gene 1 protein homolog 1
  • Protein UOG-1
  • UOG1LAG1 longevity assurance homolog 1 (S. cerevisiae)
  • upstream of GDF1

Background

This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00253782-A01
Species: Hu, Mu
Applications: ELISA, WB
NBP1-76964
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
H00079603-M03
Species: Hu
Applications: ELISA, ICC/IF, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP1-91333
Species: Hu
Applications: WB
H00023471-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00008877-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB6937
Species: Hu
Applications: WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-89656
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-84536
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24686
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
NBP3-12253
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
H00010715-M01
Species: Hu
Applications: WB, ELISA

Publications for LASS1 Antibody (H00010715-M01) (0)

There are no publications for LASS1 Antibody (H00010715-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LASS1 Antibody (H00010715-M01) (0)

There are no reviews for LASS1 Antibody (H00010715-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LASS1 Antibody (H00010715-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LASS1 Products

Bioinformatics Tool for LASS1 Antibody (H00010715-M01)

Discover related pathways, diseases and genes to LASS1 Antibody (H00010715-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LASS1 Antibody (H00010715-M01)

Discover more about diseases related to LASS1 Antibody (H00010715-M01).
 

Pathways for LASS1 Antibody (H00010715-M01)

View related products by pathway.

PTMs for LASS1 Antibody (H00010715-M01)

Learn more about PTMs related to LASS1 Antibody (H00010715-M01).

Blogs on LASS1

There are no specific blogs for LASS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LASS1 Antibody (2E8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CERS1
Entrez
OMIM
Uniprot