LASP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: LASP1 Antibody [NBP3-09329] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human heart tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LASP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LASP1 Antibody - BSA Free (NBP3-09329) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LASP1 (NP_006139). Peptide sequence SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LASP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LASP1 Antibody - BSA Free

• LASP-1
• LIM and SH3 domain protein 1
• LIM and SH3 protein 1
• Metastatic lymph node gene 50 protein
• MLN 50
• MLN50Lasp-1

Background

LASP1 functions as an actin-binding protein and possibly in cytoskeletal organization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LASP1