Novus Biologicals products are now on bio-techne.com

LAP3 Antibody (4G10)

Images

 
Western Blot: LAP3 Antibody (4G10) [H00051056-M02] - Analysis of LAP3 expression in transfected 293T cell line by LAP3 monoclonal antibody (M02), clone 4G10.Lane 1: LAP3 transfected lysate(56.2 KDa).Lane 2: ...read more
Sandwich ELISA: LAP3 Antibody (4G10) [H00051056-M02] - Detection limit for recombinant GST tagged LAP3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LAP3 Antibody (4G10) Summary

Immunogen
LAP3 (NP_056991, 420 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
Specificity
LAP3 (4G10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LAP3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control. It has also been used for Western Blot.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LAP3 Antibody (4G10)

  • EC 3.4.11
  • EC 3.4.11.1
  • EC 3.4.11.5
  • EC 3.4.13.23
  • LAP
  • LAP3
  • LAPEP
  • LAPEPEC 3.4.11.1
  • leucine aminopeptidase 3Prolyl aminopeptidase
  • Leucyl aminopeptidase
  • PEPS
  • PEPScytosol aminopeptidase
  • Peptidase S
  • Peptidase SLAP-3
  • Proline aminopeptidase

Background

Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6386
Species: Hu
Applications: IP, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DCC270
Species: Hu
Applications: ELISA
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
NBP1-56928
Species: Hu
Applications: IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00051056-M02
Species: Hu
Applications: WB, ELISA

Publications for LAP3 Antibody (H00051056-M02) (0)

There are no publications for LAP3 Antibody (H00051056-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAP3 Antibody (H00051056-M02) (0)

There are no reviews for LAP3 Antibody (H00051056-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LAP3 Antibody (H00051056-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LAP3 Products

Research Areas for LAP3 Antibody (H00051056-M02)

Find related products by research area.

Blogs on LAP3

There are no specific blogs for LAP3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAP3 Antibody (4G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol LAP3
Entrez
OMIM
Uniprot