Laminin beta 1 Recombinant Protein Antigen

Images

 
There are currently no images for Laminin beta 1 Recombinant Protein Antigen (NBP2-42385PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Laminin beta 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAMB1.

Source: E. coli

Amino Acid Sequence: GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LAMB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-42385.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP2-42385PEP.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Laminin beta 1 Recombinant Protein Antigen

  • CLM
  • cutis laxa with marfanoid phenotype
  • Laminin B1 chain
  • laminin subunit beta-1
  • laminin, beta 1
  • Laminin-1 subunit beta
  • Laminin-10 subunit beta
  • Laminin-12 subunit beta
  • Laminin-2 subunit beta
  • Laminin-6 subunit beta
  • Laminin-8 subunit beta
  • MGC142015

Background

Laminins are essential and abundant structural non-collagenous glycoproteins localizing to basement membranes. Basement membranes (cell-associated extracellular matrices (ECMs)) are polymers of Laminins with stabilizing type IV collagen networks, nidogen and several proteoglycans. Basement membranes are found under epithelial layers, around the endothelium of blood vessels and surrounding muscle, peripheral nerve and fat cells. Formation of basement membranes influences cell proliferation, phenotype, migration, gene expression and tissue architecture. Each Laminin is a heterotrimer of alpha, beta and gamma chain subunits that undergoes cell-secretion and incorporation into the ECM. Laminins can self-assemble and bind to other matrix macromolecules, and have unique and shared cell interactions mediated by Integrins, dystroglycan and cognate Laminin receptors. The human Laminin gamma-1 gene maps to chromosome 1q31 and is ubiquitously expressed in tissues that produce basement membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44751
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB300-144
Species: ChHa, Hu, In, Ma, Mu, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
MAB41281
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF4478
Species: Hu
Applications: IHC, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PP-H8132-00
Species: Hu
Applications: IHC, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for Laminin beta 1 Recombinant Protein Antigen (NBP2-42385PEP)(2)

Reviews for Laminin beta 1 Recombinant Protein Antigen (NBP2-42385PEP) (0)

There are no reviews for Laminin beta 1 Recombinant Protein Antigen (NBP2-42385PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Laminin beta 1 Recombinant Protein Antigen (NBP2-42385PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Laminin beta 1 Products

Research Areas for Laminin beta 1 Recombinant Protein Antigen (NBP2-42385PEP)

Find related products by research area.

Blogs on Laminin beta 1

There are no specific blogs for Laminin beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Laminin beta 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMB1