Laminin beta 1 Antibody [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related Laminin beta 1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-35336AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Laminin beta 1 Antibody [Alexa Fluor® 700] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1467-1786 of human Laminin beta 1 (NP_002282.2).

Sequence:
EAKLRADEAKQSAEDILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Laminin beta 1 Antibody [Alexa Fluor® 700]

  • CLM
  • cutis laxa with marfanoid phenotype
  • Laminin B1 chain
  • laminin subunit beta-1
  • laminin, beta 1
  • Laminin-1 subunit beta
  • Laminin-10 subunit beta
  • Laminin-12 subunit beta
  • Laminin-2 subunit beta
  • Laminin-6 subunit beta
  • Laminin-8 subunit beta
  • MGC142015

Background

Laminins are essential and abundant structural non-collagenous glycoproteins localizing to basement membranes. Basement membranes (cell-associated extracellular matrices (ECMs)) are polymers of Laminins with stabilizing type IV collagen networks, nidogen and several proteoglycans. Basement membranes are found under epithelial layers, around the endothelium of blood vessels and surrounding muscle, peripheral nerve and fat cells. Formation of basement membranes influences cell proliferation, phenotype, migration, gene expression and tissue architecture. Each Laminin is a heterotrimer of alpha, beta and gamma chain subunits that undergoes cell-secretion and incorporation into the ECM. Laminins can self-assemble and bind to other matrix macromolecules, and have unique and shared cell interactions mediated by Integrins, dystroglycan and cognate Laminin receptors. The human Laminin gamma-1 gene maps to chromosome 1q31 and is ubiquitously expressed in tissues that produce basement membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44751
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB300-144
Species: ChHa, Hu, In, Ma, Mu, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
MAB41281
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF4478
Species: Hu
Applications: IHC, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PP-H8132-00
Species: Hu
Applications: IHC, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for Laminin beta 1 Antibody (NBP3-35336AF700) (0)

There are no publications for Laminin beta 1 Antibody (NBP3-35336AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin beta 1 Antibody (NBP3-35336AF700) (0)

There are no reviews for Laminin beta 1 Antibody (NBP3-35336AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Laminin beta 1 Antibody (NBP3-35336AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Laminin beta 1 Products

Research Areas for Laminin beta 1 Antibody (NBP3-35336AF700)

Find related products by research area.

Blogs on Laminin beta 1

There are no specific blogs for Laminin beta 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin beta 1 Antibody [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMB1